BioLiP

>protein
SMFREVRNEEGIDVPIPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGTTPERIAQITGPPDRCQHAAEIITDLLRSV
QAGN

The query sequence (length=84) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6y2c:B	84	84	1.0000	1.0000	1.0000	2.20e-57
2	1j4w:A	145	70	0.8214	0.4759	0.9857	2.01e-44	6y2c:A
3	1j4w:A	145	77	0.2619	0.1517	0.2857	6.95e-04	6y2c:A
4	4b8t:A	106	82	0.6786	0.5377	0.6951	9.62e-37
5	3vke:A	76	57	0.2738	0.3026	0.4035	5.42e-08	2axy:B, 2axy:D, 2pqu:C, 2pqu:B, 2py9:B, 2py9:C, 3vke:B, 3vke:C, 3vke:D, 1ztg:A, 1ztg:D, 1ztg:B, 1ztg:C
6	2axy:A	72	57	0.2619	0.3056	0.3860	5.94e-07	2axy:C, 2pqu:A, 2py9:A
7	1zzi:A	82	66	0.2619	0.2683	0.3333	1.45e-05	7cre:A, 1j5k:A, 1zzi:B, 1zzj:A, 1zzj:B
8	8coo:A	191	59	0.2738	0.1204	0.3898	3.23e-04	2n8l:A, 2n8m:A
9	8coo:A	191	80	0.3214	0.1414	0.3375	0.82	2n8l:A, 2n8m:A
10	1ec6:A	87	71	0.2500	0.2414	0.2958	6.82e-04	1ec6:B
11	7yey:A	162	73	0.2738	0.1420	0.3151	0.001	7vkl:A
12	2anr:A	155	64	0.2024	0.1097	0.2656	0.003	2ann:A
13	2p2r:A	73	68	0.2619	0.3014	0.3235	0.019
14	5wwx:A	84	62	0.2381	0.2381	0.3226	0.064
15	7aqq:f	101	34	0.1548	0.1287	0.3824	0.44	7a23:c, 7a24:c, 7ar7:f, 7ar8:f, 7arb:f, 8bef:f, 8bpx:f, 8bq5:f, 8bq6:f
16	4i94:A	297	47	0.2024	0.0572	0.3617	0.78	4i94:B
17	5a22:A	2002	33	0.1548	0.0065	0.3939	3.4
18	6u1x:A	2059	33	0.1548	0.0063	0.3939	3.4
19	4hcx:A	402	70	0.2262	0.0473	0.2714	3.7	4hcx:B
20	8cvo:G	214	55	0.2143	0.0841	0.3273	3.9	8crx:G
21	3qo8:A	441	33	0.1429	0.0272	0.3636	6.5	3qo7:A
22	4zv1:A	226	43	0.1548	0.0575	0.3023	8.4	4zv2:A

[Back]