SLWNWFNITNWLWYIKLFIMIVGGLVGLRIVFAV
The query sequence (length=34) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 6sne:J | 34 | 34 | 1.0000 | 1.0000 | 1.0000 | 2.11e-17 | |
| 2 | 6v4t:C | 51 | 34 | 0.8235 | 0.5490 | 0.8235 | 7.26e-15 | 6v4t:A, 6v4t:B |
| 3 | 3gwo:A | 53 | 16 | 0.4706 | 0.3019 | 1.0000 | 8.48e-06 | 5zcx:Q, 5zcx:W |
| 4 | 7z8s:E | 1514 | 22 | 0.3529 | 0.0079 | 0.5455 | 3.8 | 7zb5:E, 7zb5:H |
| 5 | 4jyy:A | 202 | 8 | 0.1765 | 0.0297 | 0.7500 | 4.1 | 4jz2:A, 4jzg:A, 3tjt:A |
| 6 | 7b0k:A | 255 | 27 | 0.3824 | 0.0510 | 0.4815 | 4.2 | |
| 7 | 5esr:A | 308 | 19 | 0.3235 | 0.0357 | 0.5789 | 6.0 | |
| 8 | 4zjl:A | 1044 | 21 | 0.2647 | 0.0086 | 0.4286 | 6.6 | 3aob:C, 3aoc:C, 3aod:A, 3aod:C, 9bfh:A, 9bfm:A, 9bfn:A, 9bft:A, 2dr6:A, 2drd:A, 4dx5:B, 4dx7:A, 4dx7:B, 8ffs:A, 5jmn:A, 5jmn:B, 5jmn:C, 5nc5:B, 5ng5:K, 5ng5:L, 5ng5:J, 7ouk:A, 7ouk:B, 7ouk:C, 7oul:A, 7oul:C, 7oum:A, 7oum:B, 7oum:C, 8p1i:A, 8p1i:B, 6q4n:A, 6q4n:B, 6q4n:C, 6q4o:B, 2rdd:A, 1t9u:A, 1t9v:A, 1t9w:A, 1t9x:A, 1t9y:A, 4u8v:B, 4u8y:B, 4u95:B, 2w1b:A, 3w9h:B, 4zjl:D, 4zjo:A, 4zjo:D, 4zjq:A, 4zjq:D, 6zo5:B, 6zo5:C, 6zo6:B, 6zo6:C, 6zo7:A, 6zo7:B, 6zo8:B, 6zo8:C, 6zo9:B, 6zob:A, 6zoc:A, 6zoc:B, 6zod:A, 6zod:B, 6zof:B, 6zog:B, 6zoh:A, 6zoh:B, 6zoh:C |
| 9 | 7z7n:E | 1306 | 19 | 0.2941 | 0.0077 | 0.5263 | 8.4 | |
| 10 | 7xoi:B | 436 | 14 | 0.2059 | 0.0161 | 0.5000 | 8.4 | 7xoi:D, 7xoi:F, 7xoi:H, 7xoi:J, 7xoi:L, 7xoi:N, 7xoi:P |
| 11 | 6hiv:AY | 340 | 19 | 0.2059 | 0.0206 | 0.3684 | 8.5 | 7aoi:AY, 6hix:AY, 6yxx:AY, 6yxy:AY |
umich.edu