SLTPRCIIVRHGQTEWSKSGQYTGLTDLPLTPYGEGQMLRTGESVFRNNQFLNPDNITYIFTSPRLRARQTVDLVLKPLS
DEQRAKIRVVVDDDLREWEYGDYEGMLTREIIELRKSRGLDKERPWNIWRDGCENGETTQQIGLRLSRAIARIQNLHRKH
QSEGRASDIMVFAHGHALRYFAAIWFGLGVQKKCETIEEIQNVKSYDDDTVPYVKLESYRHLVDNPCFLLDAGGIGVLSY
AHHNIDEPALELAGPFVSPPEEESQHGDV
The query sequence (length=269) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3lg2:A | 269 | 269 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 3lg2:B, 3lg2:C, 3lg2:D, 3ll4:A, 3ll4:B, 3oi7:A, 3oi7:B, 3oi7:C, 3oi7:D |
2 | 1qhf:A | 240 | 198 | 0.1822 | 0.2042 | 0.2475 | 6.69e-09 | 1bq3:D, 1bq3:A, 1bq4:A, 5pgm:E, 1qhf:B |
3 | 4ij6:A | 207 | 109 | 0.1115 | 0.1449 | 0.2752 | 7.65e-06 | 4ij6:B |
4 | 1h2e:A | 207 | 184 | 0.1747 | 0.2271 | 0.2554 | 1.43e-05 | 1h2f:A |
5 | 5zr2:C | 198 | 107 | 0.1115 | 0.1515 | 0.2804 | 1.96e-04 | 6m1x:C, 6m1x:D, 5zr2:A, 5zr2:B, 5zr2:D |
6 | 3mbk:A | 264 | 72 | 0.0892 | 0.0909 | 0.3333 | 5.11e-04 | 3mbk:B, 8u5m:A, 8u5m:C, 8u5m:D, 8u7e:A, 8u7e:C, 8u7e:D |
7 | 1e59:A | 239 | 109 | 0.1078 | 0.1213 | 0.2661 | 0.005 | |
8 | 4pza:B | 217 | 107 | 0.1078 | 0.1336 | 0.2710 | 0.006 | 4pza:A, 4qih:A, 4qih:B |
9 | 7xb8:B | 249 | 102 | 0.1004 | 0.1084 | 0.2647 | 0.007 | 6isn:C, 8it4:A, 8it4:B, 8it5:C, 8it6:C, 8it7:C, 8it8:C, 8itb:C, 8itc:C, 8itd:C, 7xb7:B, 7xb7:C, 7xb8:C, 7xb9:B, 7xb9:C, 5y2i:B, 5y2u:B, 5y2u:C, 5y35:C, 5y64:C, 5y65:C, 1yfk:A, 1yjx:B, 1yjx:C, 1yjx:D, 1yjx:E, 1yjx:G, 1yjx:I, 1yjx:J, 1yjx:K, 1yjx:L, 5zrm:C, 5zs8:C |
10 | 5wdi:A | 264 | 222 | 0.1970 | 0.2008 | 0.2387 | 0.018 | 5wdi:B |
11 | 3gp5:A | 248 | 48 | 0.0558 | 0.0605 | 0.3125 | 0.022 | 3fdz:A, 3gp3:A, 3gp3:B, 3gp3:C, 3gp3:D, 3gp5:B, 3gw8:A, 3gw8:B |
12 | 2h4z:A | 255 | 122 | 0.1264 | 0.1333 | 0.2787 | 0.52 | 2f90:A, 2f90:B, 2h4z:B, 2hhj:A, 2hhj:B, 7n3r:B, 7n3s:A, 7n3s:B, 7thi:A, 7thi:B |
13 | 5ftw:A | 255 | 128 | 0.1078 | 0.1137 | 0.2266 | 0.56 | |
14 | 1w2t:A | 432 | 61 | 0.0669 | 0.0417 | 0.2951 | 4.6 | 1w2t:B, 1w2t:C, 1w2t:D, 1w2t:E, 1w2t:F |
15 | 3l76:A | 585 | 52 | 0.0669 | 0.0308 | 0.3462 | 5.7 | 3l76:B |
16 | 4y2w:A | 388 | 57 | 0.0595 | 0.0412 | 0.2807 | 6.7 | 4y2w:B |