BioLiP

>protein
SLTDEELVTMSVRELNQHLRGLSKEEIVQLKQRRRTLKNRGYAASCRVKRVTQKEELEKQKAELQQEVEKLASENASMKL
ELDALRSKYEALQTFARTV

The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7x5e:E	101	99	1.0000	0.9802	1.0000	4.58e-66	3a5t:A, 3a5t:B, 7x5e:A, 7x5f:A, 7x5f:E, 7x5g:A, 7x5g:E
2	2wty:B	97	96	0.5354	0.5464	0.5521	7.87e-32	4auw:A, 4auw:B, 4auw:E, 4auw:F, 2wt7:B, 2wty:A
3	4eot:A	92	91	0.5253	0.5652	0.5714	1.24e-30	4eot:B
4	7x5e:B	106	72	0.1919	0.1792	0.2639	1.1	7x5e:F, 7x5f:B, 7x5f:F, 7x5g:B, 7x5g:F
5	5ysw:A	374	39	0.1515	0.0401	0.3846	2.1	5ysm:A
6	2e5w:A	280	55	0.1717	0.0607	0.3091	2.3	2e5w:C, 2zsu:A, 2zsu:C, 2zsu:E
7	7vuk:B	472	17	0.1010	0.0212	0.5882	2.8
8	9eq5:A	511	42	0.1616	0.0313	0.3810	5.2	9eq5:D, 9eq5:B, 9eq5:C
9	2atj:A	308	39	0.1515	0.0487	0.3846	6.7	1atj:A, 1atj:B, 1atj:C, 1atj:D, 1atj:E, 1atj:F, 2atj:B, 3atj:A, 3atj:B, 4atj:A, 4atj:B, 6atj:A, 7atj:A, 1gw2:A, 1gwo:A, 1gwt:A, 1gwu:A, 1gx2:A, 1gx2:B, 1h55:A, 1h57:A, 1h58:A, 1h5a:A, 1h5c:A, 1h5d:A, 1h5e:A, 1h5f:A, 1h5g:A, 1h5h:A, 1h5i:A, 1h5j:A, 1h5k:A, 1h5l:A, 1h5m:A, 1hch:A, 1kzm:A, 1w4w:A, 1w4y:A, 2ylj:A
10	8i0k:A	875	46	0.1515	0.0171	0.3261	7.7	8i0k:B, 7wgr:A, 7wgr:B
11	7nyw:B	858	41	0.1414	0.0163	0.3415	9.7

[Back]