SLTDAKIRTLKPSDKPFKVSDSHGLYLLVKPGGSRHWYLKYRISGKESRIALGAYPAISLSDARQQREGIRKMLALN
The query sequence (length=77) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3rmp:A | 77 | 77 | 1.0000 | 1.0000 | 1.0000 | 4.64e-52 | 3rmp:C |
2 | 6g84:B | 368 | 46 | 0.2468 | 0.0516 | 0.4130 | 0.056 | 6g84:A, 6g85:A, 6g85:B, 6g86:A, 6g86:B, 5xw5:A |
3 | 6jj7:A | 465 | 40 | 0.1299 | 0.0215 | 0.2500 | 0.25 | 6jj7:C, 6jj7:E, 6jj8:C, 6jj8:A, 6jj8:B, 6jj9:C, 6jj9:A, 6jj9:E, 5zqt:A, 5zqt:B, 5zqt:C |
4 | 2uvp:C | 186 | 19 | 0.1299 | 0.0538 | 0.5263 | 1.3 | 2uvp:B |
5 | 6ksv:A | 427 | 32 | 0.1558 | 0.0281 | 0.3750 | 1.8 | 6ksv:B |
6 | 1fr6:A | 361 | 19 | 0.1169 | 0.0249 | 0.4737 | 8.2 | 1fr6:B, 8jb8:A, 8jb8:B, 1rgy:A |
7 | 6h6v:F | 446 | 59 | 0.1948 | 0.0336 | 0.2542 | 8.6 | 6h6v:A, 6h6v:B, 6h6v:C, 6h6v:D, 6h6v:E, 6h6x:B, 6h6x:A |