SLSNSSKVSVLISLLEKSRDLDYIINQLEHSLQCAYFAQRSGADNEMVLAALLHDLGHYCNTSFEDMGGYGVWQHEKVGA
DYLRGLGFSERVACLIEGHVAAKRYLVSSKASYLKNLSDASRKTLEYQGGPMDEGERRLFEEREDFKDCLKIRAWDEKGK
QTDLKVPGPEHYRKMMEEHLSE
The query sequence (length=182) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4mlm:A | 188 | 186 | 1.0000 | 0.9681 | 0.9785 | 8.06e-132 | 4mlm:B, 4mln:A, 4mln:B, 4n6w:A, 4n71:A, 4n71:B, 4n71:D, 4n71:E |
2 | 6npa:A | 188 | 187 | 0.3297 | 0.3191 | 0.3209 | 1.10e-28 | 6npa:B, 6npa:C, 6npa:D |
3 | 8jpx:B | 770 | 45 | 0.0989 | 0.0234 | 0.4000 | 0.16 | 8jpx:A |
4 | 1z26:A | 716 | 45 | 0.0989 | 0.0251 | 0.4000 | 0.16 | 1z25:A |
5 | 6laa:A | 753 | 102 | 0.1538 | 0.0372 | 0.2745 | 1.1 | 6gii:A, 6ldl:A |
6 | 8tjj:C | 330 | 57 | 0.1099 | 0.0606 | 0.3509 | 1.4 | 8tjj:A, 8tjj:B, 8tjj:D, 8tjk:A, 8tjk:B |
7 | 5eks:A | 355 | 91 | 0.1484 | 0.0761 | 0.2967 | 2.3 | 5eks:B |
8 | 3iht:A | 163 | 82 | 0.1154 | 0.1288 | 0.2561 | 3.9 | |
9 | 6lla:B | 363 | 44 | 0.1044 | 0.0523 | 0.4318 | 4.6 | 6lk2:A, 6lk2:B, 6lk2:C, 6lk2:D, 6lla:A, 6lla:C, 6lla:D |
10 | 4lv4:A | 320 | 49 | 0.0879 | 0.0500 | 0.3265 | 5.0 | |
11 | 4del:A | 345 | 49 | 0.0879 | 0.0464 | 0.3265 | 5.1 | 4a22:A, 4a22:B, 4def:A, 3ekl:A, 3ekz:A, 3elf:A |
12 | 2v0n:A | 459 | 42 | 0.0769 | 0.0305 | 0.3333 | 6.2 | 2v0n:B, 1w25:A, 1w25:B, 2wb4:A, 2wb4:B |
13 | 2hek:A | 369 | 39 | 0.0879 | 0.0434 | 0.4103 | 7.2 | 2hek:B |
14 | 5syt:A | 444 | 21 | 0.0604 | 0.0248 | 0.5238 | 7.5 | 4aw6:A, 4aw6:B, 4aw6:D, 4aw6:E, 6bh8:B |
15 | 3wfr:H | 463 | 58 | 0.0989 | 0.0389 | 0.3103 | 7.5 | 3wfq:E, 3wfq:F, 3wfq:G, 3wfq:H, 3wfr:E, 3wfr:F, 3wfr:G, 3wfs:C, 3wfs:D |
16 | 6srg:A | 455 | 62 | 0.1154 | 0.0462 | 0.3387 | 9.4 |