SLRVEETEVFKKYFKNLTDRERAVFEGGITLGALFHQFVGTPVSKYNKESLERAIEEAMKNQPCVYDIKVKIRNVGEKYV
SLDGKMLDVDLKIKINKTVAHLKLEYIPEIDYPLMYVKKFEE
The query sequence (length=122) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 2ogf:B | 122 | 122 | 1.0000 | 1.0000 | 1.0000 | 1.10e-86 | 2ogf:A, 2ogf:C, 2ogf:D |
| 2 | 2i52:F | 119 | 112 | 0.3852 | 0.3950 | 0.4196 | 4.64e-21 | |
| 3 | 4fn5:A | 670 | 84 | 0.2213 | 0.0403 | 0.3214 | 0.17 | |
| 4 | 6r84:R | 360 | 58 | 0.1230 | 0.0417 | 0.2586 | 0.50 | 6r86:R, 6r87:R |
| 5 | 2vzs:A | 857 | 58 | 0.1475 | 0.0210 | 0.3103 | 1.1 | 2vzs:B, 2vzt:A, 2vzt:B, 2vzu:A, 2vzu:B, 2vzv:A, 2vzv:B, 2x05:A, 2x05:B, 2x09:A, 2x09:B |
| 6 | 6gtd:A | 1269 | 60 | 0.1311 | 0.0126 | 0.2667 | 1.2 | 6i1l:D, 5nfv:A, 5ng6:A, 5ng6:C, 5ng6:E, 5ng6:G |
| 7 | 7dn3:A | 1293 | 46 | 0.1311 | 0.0124 | 0.3478 | 1.5 | 7du2:A |
| 8 | 6yxs:A | 359 | 52 | 0.1066 | 0.0362 | 0.2500 | 2.3 | 3fi8:A, 6yxt:A |
| 9 | 7d58:A | 1387 | 120 | 0.2705 | 0.0238 | 0.2750 | 3.4 | 7a6h:A, 7ae1:A, 7ae3:A, 7aea:A, 7fji:A, 7fjj:A, 8ity:A, 8iue:A, 8iuh:A |
| 10 | 2fge:A | 979 | 31 | 0.1066 | 0.0133 | 0.4194 | 4.0 | 2fge:B |
| 11 | 6hs0:B | 201 | 14 | 0.0656 | 0.0398 | 0.5714 | 8.1 | 6c31:E, 6c31:F, 6c31:G, 6c31:H, 6c31:A, 6c31:B, 6c31:C, 6c31:D, 6hrw:A, 6hrx:A, 6hrx:B, 6hry:A, 6hry:B, 6hrz:A, 6hs0:A, 6hs1:B, 6hs2:B, 5icj:A, 5icj:B, 5n7o:A, 5n7o:B |
| 12 | 7dv2:A | 76 | 44 | 0.1148 | 0.1842 | 0.3182 | 9.0 | 7dv2:B, 7dv2:C, 7dv2:D |
| 13 | 6fwh:A | 196 | 57 | 0.1475 | 0.0918 | 0.3158 | 9.9 | 6fwh:C, 6fwh:F, 6fwh:B, 6fwh:K, 6fwh:G, 6fwh:L, 6fwh:E, 6fwh:D, 6fwh:H, 6fwh:J, 6fwh:I |
umich.edu