SLRRGIYHIENAGVPSAIDLKDGSSSDGTPIVGWQFTPDTINWHQLWLAEPIPNVADTFTLANLFSGTYMDLYNGSSEAG
The query sequence (length=292) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
5d61:A |
292 |
292 |
0.9966 |
0.9966 |
0.9966 |
0.0 |
5d62:A, 5d63:A, 3ef2:A, 3ef2:B, 3ef2:C, 3ef2:D, 2iho:A, 5mu9:A, 6tsl:AAA, 6tsm:AAA, 6tsn:AAA, 6tso:AAA, 6tsp:AAA, 6tsq:AAA, 6tsr:AAA, 6yh0:AAA |
2 |
3phz:A |
278 |
292 |
0.3733 |
0.3921 |
0.3733 |
6.84e-53 |
5mua:A, 5mua:B, 3phz:B |
3 |
3vsz:C |
482 |
147 |
0.1301 |
0.0788 |
0.2585 |
0.051 |
3vsz:A, 3vsz:B, 3vsz:E, 3vsz:F, 3vt0:A, 3vt0:B, 3vt0:C, 3vt0:E, 3vt0:F, 3vt1:B, 3vt1:C, 3vt1:E, 3vt1:F, 3vt1:A, 3vt2:A, 3vt2:B, 3vt2:C, 3vt2:D, 3vt2:E, 3vt2:F |
4 |
3vsz:C |
482 |
47 |
0.0582 |
0.0353 |
0.3617 |
0.16 |
3vsz:A, 3vsz:B, 3vsz:E, 3vsz:F, 3vt0:A, 3vt0:B, 3vt0:C, 3vt0:E, 3vt0:F, 3vt1:B, 3vt1:C, 3vt1:E, 3vt1:F, 3vt1:A, 3vt2:A, 3vt2:B, 3vt2:C, 3vt2:D, 3vt2:E, 3vt2:F |
5 |
5bp5:A |
286 |
59 |
0.0685 |
0.0699 |
0.3390 |
0.054 |
5bp5:B, 5bqu:B, 5bqu:A, 4lo1:A, 4lo1:B, 4lo2:A, 4lo2:B, 4lo3:A, 4lo3:B |
6 |
2a21:A |
263 |
49 |
0.0582 |
0.0646 |
0.3469 |
0.29 |
2a21:B, 2a2i:A, 2a2i:B, 3e0i:A, 3e0i:B, 3e12:A, 3e12:B, 2ef9:A, 2ef9:B, 1fwn:A, 1fwn:B, 1fws:A, 1fws:B, 1fwt:A, 1fwt:B, 1fww:A, 1fww:B, 1fx6:A, 1fx6:B, 1fxp:A, 1fxp:B, 1fxq:A, 1fxq:B, 1fy6:A, 1fy6:B, 1jcx:A, 1jcx:B, 1jcy:A, 1jcy:B, 1lrn:A, 1lrn:B, 1lro:A, 1lro:B, 1lrq:A, 1lrq:B, 2nwr:A, 2nwr:B, 2nws:A, 2nws:B, 2nx1:A, 2nx1:B, 2nx3:A, 2nx3:B, 2nx3:C, 2nx3:D, 2nx3:E, 2nx3:F, 2nx3:G, 2nx3:H, 2nx3:I, 2nx3:J, 2nx3:K, 2nx3:L, 2nxg:A, 2nxg:B, 2nxh:A, 2nxh:B, 2nxh:C, 2nxh:D, 2nxh:E, 2nxh:F, 2nxh:G, 2nxh:H, 2nxh:I, 2nxh:J, 2nxh:K, 2nxh:L, 2nxi:A, 2nxi:B, 2nxi:C, 2nxi:D, 2nxi:E, 2nxi:F, 2nxi:G, 2nxi:H, 2nxi:I, 2nxi:J, 2nxi:K, 2nxi:L, 1pck:A, 1pck:B, 1pcw:A, 1pcw:B, 1pe1:A, 1pe1:B, 1t8x:A, 1t8x:B, 1t96:A, 1t96:B, 1zha:A, 1zha:B, 1zji:A, 1zji:B |
7 |
3fhq:A |
601 |
52 |
0.0685 |
0.0333 |
0.3846 |
0.56 |
3fha:A, 3fha:B, 3fha:C, 3fha:D, 3fhq:B, 3fhq:D, 3fhq:F |
8 |
8jvi:B |
604 |
21 |
0.0411 |
0.0199 |
0.5714 |
3.0 |
8fca:A, 8fca:B, 8fca:C, 8fca:D, 8j1b:A, 8j1b:B, 8j1b:C, 8j1b:D, 8j1f:A, 8j1f:B, 8j1f:C, 8j1f:D, 8j1h:C, 8j1h:D, 8j1h:B, 8j1h:A, 8jvi:C, 8jvi:D, 8jvi:A |
9 |
8t1b:A |
644 |
21 |
0.0411 |
0.0186 |
0.5714 |
3.5 |
4dx2:A, 8fc7:A, 8fc7:B, 8fc7:C, 8fc7:D, 8fc8:A, 8fc8:B, 8fc8:D, 8fc8:C, 8fcb:A, 8fcb:B, 8fcb:D, 8fcb:C, 8ju5:D, 8ju5:B, 8ju6:A, 8ju6:B, 8ju6:D, 8ju6:C, 8jvj:A, 8jvj:B, 8jvj:C, 8jvj:D, 8t1b:B, 8t1b:D, 8t1b:C, 8t1d:A, 8t1d:B, 8t1d:C, 8t1d:D, 8t1e:A, 8t1e:B, 8t1e:C, 8t1e:D, 8t1f:A, 8t1f:B, 8t1f:C, 8t1f:D |
10 |
1hwm:B |
264 |
69 |
0.0685 |
0.0758 |
0.2899 |
5.3 |
1hwn:B, 1hwo:B, 1hwp:B |
11 |
8pos:A |
168 |
51 |
0.0514 |
0.0893 |
0.2941 |
6.3 |
8por:A, 8pos:B |
12 |
3ca1:A |
257 |
70 |
0.0616 |
0.0700 |
0.2571 |
7.6 |
3ca4:A, 3ca5:A, 3cah:A |
13 |
3qcp:A |
410 |
41 |
0.0445 |
0.0317 |
0.3171 |
8.1 |
3qd9:A, 3qd9:B, 3qd9:C, 3qd9:D |