SLRDFFRGISANFELGKDFLREMNTPIHVSEAVFLPLSLCTLSPGRCLRLSPFHSLTLGSHCEICINRSQFSSTQLSFFN
NVIIPNKTFYVSLLVKAGLSQPSLLYAYLVTGHFCGTICPIFSTGKGRLIMHLLLQGTSLHIPETCLKLLCENIGPTYEL
AVDLVGDAFCIKVSPRDTVYEDLECGDELRLQIINYTQLILEN
The query sequence (length=203) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7t7i:D | 242 | 234 | 1.0000 | 0.8388 | 0.8675 | 9.87e-135 | 7t7i:B, 7t7i:H, 7t7i:J |
2 | 7t7i:F | 208 | 212 | 0.9113 | 0.8894 | 0.8726 | 4.35e-119 | |
3 | 5dob:A | 237 | 171 | 0.2118 | 0.1814 | 0.2515 | 1.18e-09 | 5d5n:B, 5doc:A, 5doc:B, 5doe:B |
4 | 4f3w:B | 121 | 51 | 0.0985 | 0.1653 | 0.3922 | 0.47 | 4f3w:A, 4f3w:C, 4f3w:D |
5 | 9c20:A | 451 | 61 | 0.0887 | 0.0399 | 0.2951 | 4.3 | 8url:A, 8uvv:A |
6 | 6kw6:A | 119 | 51 | 0.0936 | 0.1597 | 0.3725 | 6.3 | 6kw6:B |
7 | 3r2n:D | 122 | 48 | 0.0788 | 0.1311 | 0.3333 | 7.6 | 3r2n:A, 3r2n:B, 3r2n:C |