SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLS
EFGQFLPDA
The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1g1e:B | 89 | 89 | 1.0000 | 1.0000 | 1.0000 | 5.13e-62 | 1s5q:B, 1s5r:B |
2 | 1e91:A | 85 | 82 | 0.5843 | 0.6118 | 0.6341 | 1.03e-31 | 1pd7:A |
3 | 6xdj:A | 441 | 83 | 0.5169 | 0.1043 | 0.5542 | 2.57e-21 | 6xaw:A, 6xdj:B |
4 | 2czy:A | 77 | 81 | 0.2809 | 0.3247 | 0.3086 | 3.45e-07 | |
5 | 5y95:A | 80 | 82 | 0.2697 | 0.3000 | 0.2927 | 9.81e-07 | |
6 | 6ymv:A | 887 | 30 | 0.1348 | 0.0135 | 0.4000 | 1.9 | |
7 | 8c5s:A | 924 | 30 | 0.1348 | 0.0130 | 0.4000 | 2.1 | 8ap1:A, 8att:A, 8atv:A, 8atw:A, 8c5u:A, 8q63:A, 6ymw:A |
8 | 5hfi:A | 202 | 15 | 0.1011 | 0.0446 | 0.6000 | 4.1 | |
9 | 2azq:A | 309 | 69 | 0.2135 | 0.0615 | 0.2754 | 4.3 | |
10 | 8ow1:II | 704 | 62 | 0.2135 | 0.0270 | 0.3065 | 5.7 | 8ovw:I |
11 | 3q4r:A | 170 | 58 | 0.1798 | 0.0941 | 0.2759 | 9.9 | 3q4o:A, 3q4q:A |