SLLDPLTQLWNRAGFHALHQHELELARASDQRIGIIYSDIDHFKRINDTLGHRAGDSVLREAASRLRAALRPEDLLARFG
GEEFVAMVRVRETTELTMIANRIRELMEATPIDCAGTSVPVTISAGCTLAGSGEEPERALARADAALYDAKRAGRNRVVS
V
The query sequence (length=161) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4zmm:A | 164 | 161 | 1.0000 | 0.9817 | 1.0000 | 4.15e-116 | 4zmm:B |
2 | 3ign:A | 166 | 162 | 0.3913 | 0.3795 | 0.3889 | 5.75e-30 | |
3 | 4wxw:A | 165 | 157 | 0.4161 | 0.4061 | 0.4268 | 1.18e-28 | |
4 | 4zvf:A | 164 | 157 | 0.3416 | 0.3354 | 0.3503 | 2.78e-27 | |
5 | 2v0n:A | 459 | 162 | 0.4099 | 0.1438 | 0.4074 | 3.12e-25 | 2v0n:B, 1w25:A, 1w25:B, 2wb4:A, 2wb4:B |
6 | 6hbz:B | 270 | 141 | 0.3354 | 0.2000 | 0.3830 | 6.70e-25 | 6hbz:A, 6hc0:D, 6hc1:A |
7 | 8wcn:A | 379 | 158 | 0.4037 | 0.1715 | 0.4114 | 1.64e-24 | 8wcn:B |
8 | 7e6g:A | 264 | 159 | 0.3602 | 0.2197 | 0.3648 | 2.60e-24 | |
9 | 5euh:A | 164 | 159 | 0.3851 | 0.3780 | 0.3899 | 2.83e-23 | 5euh:B |
10 | 5m3c:B | 426 | 157 | 0.3540 | 0.1338 | 0.3631 | 1.96e-22 | 5m3c:A |
11 | 3i5c:B | 198 | 161 | 0.3478 | 0.2828 | 0.3478 | 1.14e-21 | 3i5c:A, 1ij0:A, 1ij0:B, 1ij0:C, 1ij1:A, 1ij1:B, 1ij1:C, 3k7z:A, 3k7z:B, 1rb4:A, 1rb4:B, 1swi:C, 6xne:C |
12 | 7a7e:B | 176 | 155 | 0.3727 | 0.3409 | 0.3871 | 1.67e-21 | 7a7e:A, 7a7e:C |
13 | 5xgd:A | 548 | 156 | 0.3602 | 0.1058 | 0.3718 | 1.75e-21 | 8pps:A, 8pps:B, 5xge:A |
14 | 4urs:A | 162 | 149 | 0.3106 | 0.3086 | 0.3356 | 4.58e-21 | 4urg:A, 4urs:B |
15 | 4h54:A | 274 | 138 | 0.2919 | 0.1715 | 0.3406 | 4.70e-21 | 4h54:B, 3t9o:A, 3tvk:A |
16 | 6zxb:A | 293 | 162 | 0.3230 | 0.1775 | 0.3210 | 5.23e-21 | 6zxb:B, 6zxc:A, 6zxc:B, 6zxc:C, 6zxc:D, 6zxm:A, 6zxm:B, 6zxm:C, 6zxm:D, 6zxm:E, 6zxm:F |
17 | 5llw:B | 673 | 159 | 0.3292 | 0.0788 | 0.3333 | 1.07e-20 | 5llw:A, 5llx:A, 5llx:B, 5lly:D, 5lly:A, 5lly:C, 5lly:B, 6saw:A, 6saw:B, 6saw:C, 6saw:D, 6saw:E, 6saw:F, 6saw:G, 6saw:H, 6sax:B, 6sax:A |
18 | 6et7:A | 646 | 159 | 0.3292 | 0.0820 | 0.3333 | 1.13e-20 | 6et7:B |
19 | 3bre:B | 328 | 161 | 0.3478 | 0.1707 | 0.3478 | 1.40e-20 | 3bre:A |
20 | 3i5a:A | 319 | 162 | 0.3540 | 0.1787 | 0.3519 | 2.32e-19 | |
21 | 6ttr:B | 195 | 163 | 0.3665 | 0.3026 | 0.3620 | 6.55e-19 | 6ttr:A, 6tts:A, 6tts:B |
22 | 6d9m:A | 326 | 161 | 0.3292 | 0.1626 | 0.3292 | 1.55e-17 | |
23 | 8c05:A | 305 | 162 | 0.3478 | 0.1836 | 0.3457 | 1.83e-17 | |
24 | 3qyy:B | 156 | 159 | 0.3168 | 0.3269 | 0.3208 | 3.48e-17 | 3qyy:A |
25 | 5euh:D | 142 | 156 | 0.3354 | 0.3803 | 0.3462 | 1.72e-16 | 5euh:C |
26 | 4rnh:A | 423 | 158 | 0.3354 | 0.1277 | 0.3418 | 1.68e-15 | |
27 | 6pwj:A | 408 | 104 | 0.1863 | 0.0735 | 0.2885 | 5.17e-05 | 6pwj:B, 6pwk:A, 6pwk:B |
28 | 2wyh:A | 905 | 133 | 0.1801 | 0.0320 | 0.2180 | 2.5 | 2wyh:B, 2wyi:A, 2wyi:B |
29 | 5sy7:B | 276 | 74 | 0.1366 | 0.0797 | 0.2973 | 3.1 | |
30 | 6lrt:A | 423 | 47 | 0.0994 | 0.0378 | 0.3404 | 5.2 | 6lrt:D, 6lrt:G, 6lrt:J, 6lrt:M, 6lrt:P, 6lrt:S, 6lrt:V |
31 | 7sfj:A | 284 | 47 | 0.0994 | 0.0563 | 0.3404 | 5.5 | 7sfj:B, 7sfj:C, 7sfk:A, 7sfk:B, 7sfk:C, 7w9w:A |
32 | 1wz2:A | 948 | 99 | 0.1615 | 0.0274 | 0.2626 | 5.7 | 1wz2:B |
33 | 4zyj:D | 392 | 114 | 0.2236 | 0.0918 | 0.3158 | 9.9 | 4zyj:A, 4zyj:B, 4zyj:C |