SLINLKIQKENPKVVNEINIEDLSLTKAAYCRCWRSKTFPACDGSCNKHNELTGDNVGPLILKKK
The query sequence (length=65) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3fnv:B | 68 | 65 | 0.9846 | 0.9412 | 0.9846 | 3.03e-42 | 3fnv:A, 4oo7:A, 4oo7:B, 4ooa:A, 4ooa:B, 4ooa:C, 4ooa:D, 4ooa:E, 4ooa:F, 7p0p:A, 7p0p:B, 7p0p:C, 7p0p:D |
2 | 3ew0:A | 77 | 65 | 0.6769 | 0.5714 | 0.6769 | 1.18e-28 | 6de9:A, 3ew0:B, 4ezf:A, 4ezf:B, 4f1e:A, 4f1e:B, 4f1e:C, 4f1e:D, 4f1e:E, 4f1e:F, 4f1e:G, 4f1e:H, 4f1e:I, 4f1e:J, 4f1e:K, 4f1e:L, 4f1e:M, 4f1e:N, 4f1e:O, 4f1e:P, 4f1e:Q, 4f1e:R, 4f28:A, 4f28:B, 4f2c:A, 4f2c:B, 3lpq:A, 3lpq:B, 7p0o:A, 7p0o:B, 2qd0:A, 2qd0:B, 2qh7:A, 2qh7:B, 2r13:A, 3ree:A |
3 | 3s2r:B | 78 | 63 | 0.5692 | 0.4744 | 0.5873 | 2.96e-22 | 3s2q:A, 3s2q:B, 3s2r:A |
4 | 7yvz:A | 63 | 60 | 0.5231 | 0.5397 | 0.5667 | 7.91e-20 | |
5 | 6avj:A | 92 | 31 | 0.2000 | 0.1413 | 0.4194 | 0.22 | 6avj:B, 6avj:C |
6 | 8iu2:R | 298 | 19 | 0.1538 | 0.0336 | 0.5263 | 0.72 | |
7 | 4ntc:A | 325 | 44 | 0.2000 | 0.0400 | 0.2955 | 3.5 | 4ntc:B |
8 | 3tbn:A | 87 | 16 | 0.1538 | 0.1149 | 0.6250 | 3.5 | |
9 | 1mvm:A | 549 | 28 | 0.1538 | 0.0182 | 0.3571 | 6.5 | 1z1c:A |
10 | 3tbo:A | 54 | 15 | 0.1231 | 0.1481 | 0.5333 | 6.6 | |
11 | 8bn0:A | 342 | 32 | 0.2154 | 0.0409 | 0.4375 | 7.2 | 8bai:A, 8bai:B, 8bai:C, 8bai:D, 8baz:A, 8baz:B, 8bb0:A, 8bb0:B, 8bmy:A, 8bmy:B, 8bmz:A, 8bmz:B |
12 | 3tbm:A | 61 | 19 | 0.1538 | 0.1639 | 0.5263 | 9.1 | 3tbm:B |
13 | 2qxf:A | 433 | 24 | 0.1692 | 0.0254 | 0.4583 | 9.9 |