SLFFKSKDVMIFNGLVALGTVGSQELFSVVAFHCPCSPARNYLYGLAAIGVPALVLFIIGIILNNHTWNLVAECQHRRTK
NCSAAPTFLLLSSILGRAAVAPVTWSVISLLRGEAYVCALSEFVDPSSLTAREEHFPSAHATEILARFPCKENPDNLSDF
REEVSRRLRYESQLFGWLLIGVVAILVFLTKCLKHYCSPLSYRQEAYWAQYRANEDQLFQRTAEVHSRVLAANNVRRFFG
FVALNKDDEELIANFPVEGTQPRPQWNAITGVYLYRENQGLPLYSRLHKWAQGL
The query sequence (length=294) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6uiw:A | 294 | 294 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 6uiw:B, 6uiw:C, 6uiw:D, 6uiw:E, 6uiw:F, 6uiw:G, 6uiw:H, 6uiw:I, 6uiw:J, 6uiw:K |
2 | 6lmt:A | 254 | 248 | 0.2279 | 0.2638 | 0.2702 | 1.76e-31 | 6lmt:B, 6lmt:H, 6lmt:C, 6lmt:D, 6lmt:E, 6lmt:F, 6lmt:G |
3 | 8kdb:A | 2117 | 56 | 0.0476 | 0.0066 | 0.2500 | 6.5 | 8kdc:A |
4 | 8axs:A | 573 | 58 | 0.0476 | 0.0244 | 0.2414 | 8.7 | 8axi:A, 8axi:B, 8axs:B, 8axt:A, 8axt:B, 8hls:A, 8hls:B |