SLDILTPTTLTGDQTFNEDVSVVSSLTLNDGSQYLFNNLLQIAPSSASVTANALAAVSVFTFSLPPSSSLSNSGTLIISN
SNTGPSTEQHIVITPNVMANTGTITLSLAHTNTDSSSTLIIDPVTFYNTGTINYESIGSETNDPSLTGNILSIGSSGRTL
QNLGTINLNAANSYYLLGTITENSGSINVQKGFLYVNALDFIGNTINLSTTTALAFISPVSQVVRVRGVFFGNIIASVGS
SGTFSYNTQTGILTVTTNGVYSYDIGCGYNPALMSGQQETLSFQGNLYDTFLVLVNQPIPSDLTCAA
The query sequence (length=307) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7o9q:B | 308 | 307 | 1.0000 | 0.9968 | 1.0000 | 0.0 | 7o9q:A |
2 | 6ojt:B | 481 | 185 | 0.1401 | 0.0894 | 0.2324 | 0.27 | 6ojr:A, 6ojt:A, 6ojw:B, 6ojw:A |
3 | 4xmh:A | 185 | 60 | 0.0619 | 0.1027 | 0.3167 | 1.8 | 5m6j:A, 5m6k:A, 4xmc:A, 4xmd:A, 4xme:A, 4xmf:A, 4xmg:A |
4 | 2glx:A | 332 | 60 | 0.0651 | 0.0602 | 0.3333 | 2.8 | 2glx:B, 2glx:C, 2glx:D, 2glx:E, 2glx:F |
5 | 4lgj:A | 256 | 73 | 0.0619 | 0.0742 | 0.2603 | 3.2 | |
6 | 7ase:A | 483 | 73 | 0.0586 | 0.0373 | 0.2466 | 4.5 | |
7 | 1o91:C | 131 | 28 | 0.0423 | 0.0992 | 0.4643 | 4.8 | |
8 | 7ajt:CD | 380 | 33 | 0.0391 | 0.0316 | 0.3636 | 4.9 | 7aju:CD, 7d4i:3D, 7d5s:3D, 7d5t:3D, 7d63:3D, 6ke6:3D, 6lqp:3D, 6lqq:3D, 6lqr:3D, 6lqs:3D, 6lqt:3D, 6lqu:3D, 6lqv:3D, 6nd4:a, 7suk:SA, 5wlc:SA, 5wyj:3D, 5wyk:3D, 6zqa:CD, 6zqb:CD, 6zqc:CD, 6zqd:CD |