SLAKVWMYASWIPRGIPKAMANELSSAAAALAHPEAIARVAQLESQGKNPYRVARAEFWQMYLACWPYRFRNTVVEWETC
KAKVLKGSVDLQDIVDLLYLLAWAYLFWILGEIYGRGSLYGYRFDGEIHRQEAQNVILYKEKEAQEMAVVMEKLEKEIQE
WLKTME
The query sequence (length=166) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6tdu:M | 166 | 166 | 1.0000 | 1.0000 | 1.0000 | 1.39e-121 | 6tdu:m, 6tdv:M, 6tdv:m |
2 | 6hyp:A | 2272 | 108 | 0.1325 | 0.0097 | 0.2037 | 1.1 | |
3 | 7cfs:A | 426 | 56 | 0.0964 | 0.0376 | 0.2857 | 2.9 | 7cfs:B, 7cfs:C, 6cmc:A, 4ntw:A, 4ntx:A, 2qts:C, 2qts:B, 2qts:A, 2qts:D, 2qts:E, 2qts:F, 6x9h:A, 6x9h:B, 6x9h:C |
4 | 3w0l:B | 598 | 39 | 0.0783 | 0.0217 | 0.3333 | 3.8 | 3w0l:D |
5 | 2f5x:B | 300 | 43 | 0.0904 | 0.0500 | 0.3488 | 5.3 | 2f5x:A, 2f5x:C |
6 | 3egd:B | 731 | 57 | 0.1145 | 0.0260 | 0.3333 | 5.4 | 3egx:B, 8hr0:B, 2nup:B, 2nut:B, 5vne:B, 5vnf:B, 5vng:B, 5vnh:B, 5vni:B, 5vnj:B, 5vnk:B, 5vnl:B, 5vnm:B, 5vnn:B, 5vno:B |
7 | 6szw:C | 186 | 33 | 0.0723 | 0.0645 | 0.3636 | 6.2 | 6szw:A, 6szw:B |
8 | 4ce5:A | 325 | 43 | 0.0843 | 0.0431 | 0.3256 | 8.9 | 4ce5:B, 8x1f:A, 8x1f:B, 7xg5:A, 7xg5:B, 8xiy:A, 8xiy:B |