SKTIVLSVGEATRTLTEIQSTRQIFEEKVGPLVGRLRLTASLRQNGAKTAYRVNLKLDQADVVDSGLPKVRYTQVWSHDV
TIVANSTEASRKSLYDLTKSLVATSQVEDLVVNLVPLGR
The query sequence (length=119) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8tux:ab | 127 | 127 | 0.9832 | 0.9213 | 0.9213 | 1.05e-76 | 2qux:A, 2qux:B, 2qux:E, 2qux:D, 2qux:G, 2qux:H, 2qux:J, 2qux:K, 2qux:M, 2qux:N, 2qux:P, 2qux:Q |
2 | 6yfk:AO | 137 | 100 | 0.2605 | 0.2263 | 0.3100 | 0.007 | 6yfk:BG, 6yfk:AU, 6yfk:AC |
3 | 8hkx:AS5P | 204 | 51 | 0.1597 | 0.0931 | 0.3725 | 0.044 | 8hky:AS5P, 8hkz:AS5P, 8hl1:AS5P, 8hl2:AS5P, 8hl3:AS5P, 8hl4:AS5P, 8hl5:AS5P, 8wkp:AS5P, 8wq2:AS5P, 8wq4:AS5P |
4 | 8opr:A | 651 | 60 | 0.1345 | 0.0246 | 0.2667 | 0.79 | |
5 | 4glr:H | 229 | 71 | 0.1597 | 0.0830 | 0.2676 | 0.93 | 4glr:J |
6 | 4onf:H | 212 | 92 | 0.1933 | 0.1085 | 0.2500 | 6.2 | 4ong:H |
7 | 7pkq:o | 163 | 48 | 0.1176 | 0.0859 | 0.2917 | 6.7 | |
8 | 7phf:B | 270 | 62 | 0.1765 | 0.0778 | 0.3387 | 9.2 |