SKSKMIVRTKFIDRACHWTVVICFFLVALSGISFFFPTLQWLTQTFGTPQMGRILHPFFGIAIFVALMFMFVRFVHHNIP
DKKDIPWLLNIVEVLKGNEHKVADVGKYNAGQKMMFWSIMSMIFVLLVTGVIIWRPYFAQYFPMQVVRYSLLIHAAAGII
LIHAILIHMYMAFWVKGSIKGMIEGKVSRRWAKKHHPRWYREIEKAEAKKESEEGI
The query sequence (length=216) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1kqf:C | 216 | 216 | 1.0000 | 1.0000 | 1.0000 | 9.15e-161 | 1kqg:C |
2 | 1rq5:A | 602 | 127 | 0.1389 | 0.0498 | 0.2362 | 0.65 | |
3 | 8bdc:A | 963 | 130 | 0.1296 | 0.0291 | 0.2154 | 1.5 | 8bdc:B, 8bdc:C, 8bdc:D |
4 | 5h2c:A | 251 | 46 | 0.0741 | 0.0637 | 0.3478 | 2.5 | |
5 | 6gi5:B | 271 | 93 | 0.1065 | 0.0849 | 0.2473 | 3.5 | 6gi1:A, 6gi1:B, 6gi2:A, 6gi2:B, 6gi5:A |
6 | 6inw:B | 390 | 70 | 0.0833 | 0.0462 | 0.2571 | 5.2 | 6inw:A, 6iv7:A, 6iv7:B, 6ix3:A, 6ix3:B, 6ix5:A, 6ix5:B, 6ix7:A, 6ix7:B, 6ix8:A, 6ix8:B, 6ix9:A, 6ix9:B, 6j1o:A, 6j1o:B, 6j24:B, 6j24:A, 6j46:A, 6j46:B, 5zzd:A, 5zzd:B |
7 | 3afl:A | 766 | 15 | 0.0463 | 0.0131 | 0.6667 | 5.4 | |
8 | 7w55:R | 303 | 105 | 0.1111 | 0.0792 | 0.2286 | 6.4 | 7w57:R, 7xk8:R |