SKPRILLMGLRRSGKNSIQKVVFHNSSFVNFQIWEMIFRGTGALIYVIDAQDDYMEALTRLHITVSKAYKVNPDMNFEVF
IHKVDGLSDDHKIETQRDIHQRANDDLADAGLEKLHLSFYLTSIYDHSIFEAFSKVVQKLIPQLPTLENLLNIFISNSGI
EKAFLFDVVSKIYIATDSSPVDMQSYELCCDMIDVVIDVSCIYGLKEDGSGSAYDKESMAIIKLNNTTVLYLKEVTKFLA
LVCILREESFERKGLIDYNFHCFRKAIHEVFE
The query sequence (length=272) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6s6d:C | 284 | 282 | 1.0000 | 0.9577 | 0.9645 | 0.0 | |
2 | 6ulg:G | 310 | 308 | 0.9926 | 0.8710 | 0.8766 | 0.0 | 8dhb:A, 3llu:A, 6nzd:G, 2q3f:A, 2q3f:B, 6s6a:C, 6s6a:D, 6s6d:D, 6sb0:D, 6sb0:J, 6sb2:D, 6sb2:J, 7t3b:E, 7t3c:E, 6u62:C, 7ux2:C, 7ux2:J, 7uxc:E, 7uxc:L, 7uxh:G, 7uxh:N, 7uxh:W, 7uxh:d, 6wj2:G, 6wj3:G |
3 | 8fw5:E | 285 | 282 | 0.6213 | 0.5930 | 0.5993 | 2.98e-118 | |
4 | 4arz:B | 304 | 309 | 0.5000 | 0.4474 | 0.4401 | 1.24e-84 | 6jwp:B, 3r7w:B, 3r7w:D |
5 | 8fw5:D | 301 | 221 | 0.2132 | 0.1927 | 0.2624 | 6.47e-10 | |
6 | 6nzd:F | 227 | 173 | 0.1765 | 0.2115 | 0.2775 | 8.52e-10 | |
7 | 6ces:A | 300 | 215 | 0.2059 | 0.1867 | 0.2605 | 1.44e-09 | 8dhb:B, 6s6a:A, 6s6a:B, 6s6d:A, 6s6d:B, 6sb0:C, 6sb0:I, 6sb2:C, 6sb2:I, 7t3a:K, 7t3b:D, 7t3c:D, 7t3c:K, 6u62:B, 6ulg:F, 7ux2:B, 7ux2:I, 7uxc:D, 7uxc:K, 7uxh:F, 7uxh:M, 7uxh:V, 7uxh:c, 6wj2:F, 6wj3:F |
8 | 4arz:A | 291 | 229 | 0.1912 | 0.1787 | 0.2271 | 1.39e-06 | 6jwp:A, 6jwp:F, 3r7w:A, 3r7w:C |
9 | 7rll:B | 177 | 83 | 0.0919 | 0.1412 | 0.3012 | 0.24 | 7rll:A |
10 | 3aq4:A | 170 | 83 | 0.0882 | 0.1412 | 0.2892 | 0.44 | 3aq4:B |
11 | 4y0v:A | 165 | 72 | 0.0735 | 0.1212 | 0.2778 | 1.4 | 4y0v:B, 4ylg:A, 4ylg:B |
12 | 3o47:A | 289 | 73 | 0.0772 | 0.0727 | 0.2877 | 2.1 | 4c0a:C, 4c0a:D, 4c0a:G, 4c0a:H, 6cm9:C, 6cm9:H, 6cri:C, 6cri:H, 6cri:K, 6cri:U, 6cri:L, 6cri:V, 6d83:C, 6d83:H, 6d84:C, 6d84:H, 6d84:I, 6d84:N, 6dff:C, 6dff:H, 7dn8:D, 7dn8:B, 7dn8:F, 7dn8:H, 7dn9:B, 7dn9:D, 7dn9:F, 7dn9:H, 3dwd:A, 3dwd:B, 4hmy:C, 6ii6:C, 6ii6:D, 1j2j:A, 2j59:A, 2j59:B, 2j59:C, 2j59:D, 2j59:E, 2j59:F, 7mge:E, 1o3y:A, 1o3y:B, 3o47:B, 8p50:B, 7r4h:C, 7r4h:H, 1r8q:A, 1r8q:B, 1r8s:A, 1re0:A, 1rrf:A, 1rrg:A, 1rrg:B, 1s9d:A, 8sdw:A, 1u81:A, 7wqy:A, 7wqy:B |
13 | 6pta:A | 165 | 73 | 0.0735 | 0.1212 | 0.2740 | 2.2 | 6pta:B, 6pta:C, 6pta:D, 5uf8:A, 5uf8:B, 5uf8:C |
14 | 8oun:A | 181 | 45 | 0.0478 | 0.0718 | 0.2889 | 3.8 | 8oum:A, 8oum:B, 8oum:C, 8oum:D, 8oum:E, 8oun:B |
15 | 1dek:A | 241 | 56 | 0.0699 | 0.0788 | 0.3393 | 4.2 | 1dek:B, 1del:A, 1del:B |
16 | 5uf8:D | 160 | 74 | 0.0699 | 0.1187 | 0.2568 | 4.3 | |
17 | 7sl4:A | 786 | 104 | 0.0919 | 0.0318 | 0.2404 | 6.0 | 8dtm:B |
18 | 7sl6:A | 819 | 104 | 0.0919 | 0.0305 | 0.2404 | 6.5 | 7mqs:F, 7mqs:E, 7sl1:A, 7sl1:B, 7sl2:A, 7sl2:B, 7sl6:B, 7sl7:A, 7sl7:B |
19 | 2b6h:A | 171 | 73 | 0.0735 | 0.1170 | 0.2740 | 6.7 | |
20 | 5de3:A | 166 | 78 | 0.0882 | 0.1446 | 0.3077 | 7.1 | 5di3:A |
21 | 9bh5:CX | 119 | 63 | 0.0699 | 0.1597 | 0.3016 | 7.3 | 9cai:CX |
22 | 6a8d:A | 181 | 78 | 0.0699 | 0.1050 | 0.2436 | 8.6 | |
23 | 3lrp:A | 181 | 92 | 0.0882 | 0.1326 | 0.2609 | 9.0 | |
24 | 2x77:A | 181 | 80 | 0.0772 | 0.1160 | 0.2625 | 9.4 | 2x77:B |