SKLVLTGERHYTRNDDIRQSILALQDVNIIQTQIEQRLPWIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTF
SVPPERTSKQVLPMLYGPEGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLARFVE
LYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLP
The query sequence (length=195) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5z2w:A | 209 | 203 | 1.0000 | 0.9330 | 0.9606 | 2.34e-142 | 6h9n:A, 6h9o:A, 6h9o:C |
2 | 4v6m:AZ | 98 | 46 | 0.1949 | 0.3878 | 0.8261 | 7.45e-16 | |
3 | 8bpl:A | 316 | 200 | 0.2462 | 0.1519 | 0.2400 | 4.6 | |
4 | 4ekn:B | 304 | 41 | 0.0615 | 0.0395 | 0.2927 | 8.3 | |
5 | 6ohb:A | 435 | 61 | 0.0872 | 0.0391 | 0.2787 | 9.4 | 6ohb:B, 6ohb:C, 6ohb:D, 6ohc:A, 6ohc:B, 6ohc:C, 6ohc:D |