BioLiP

>protein
SKKKLRRMNRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIK
RTGIQEMREALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRLKEKKPGDL
SDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGT
IDRTPWGELE

The query sequence (length=250) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8i0r:2	250	250	1.0000	1.0000	1.0000	0.0	8ch6:E, 6ff4:8, 6ff7:8, 8i0p:2, 8i0s:2, 8i0t:2, 8i0u:2, 8i0v:2, 8qo9:B2, 7qtt:E, 6qx9:B2, 8qxd:B2, 8r08:B2, 8r0a:B2, 8r0b:B2
2	7dvq:2	216	242	0.8160	0.9444	0.8430	3.09e-137	7abh:T, 7abi:T, 8y7e:2, 5z56:2, 5z57:2, 5z58:2
3	7vpx:2	187	246	0.7320	0.9786	0.7439	6.87e-120	7evo:2, 8hk1:2, 7onb:I, 7q4o:B, 7q4p:B, 6y50:8
4	7q3l:B	110	149	0.4080	0.9273	0.6846	1.20e-60
5	7dco:2	220	206	0.3560	0.4045	0.4320	1.14e-47	6g90:Q, 5gm6:H, 5nrl:Q, 5zwm:2
6	7s7b:F	352	54	0.0760	0.0540	0.3519	0.059	7s7b:B, 7s7c:B
7	1gxu:A	88	28	0.0480	0.1364	0.4286	0.073
8	7f8d:A	313	52	0.0680	0.0543	0.3269	4.0	7by9:A, 7by9:B, 7by9:C, 7by9:D, 7bya:A, 7bya:B, 7bya:C, 7bya:D, 7f8d:B, 7f8d:C, 7f8d:D, 7x1l:A, 7x1l:B, 7x1l:E, 7x1l:F, 7x1l:C, 7x1l:D
9	6n9u:H	645	49	0.0720	0.0279	0.3673	4.6	6n9v:H, 6n9w:H, 6n9x:H, 6p7e:D
10	5ow0:B	251	26	0.0440	0.0438	0.4231	5.0
11	6dbb:A	504	47	0.0600	0.0298	0.3191	5.5	6dbb:B, 6dbb:C
12	6p7e:C	672	49	0.0720	0.0268	0.3673	6.0	1sl0:A, 1sl0:C
13	2ajq:A	704	49	0.0720	0.0256	0.3673	6.4	2ajq:F, 6n7w:H, 6p7e:A, 6p7e:B, 1t8e:A, 1tk0:A, 1tk8:A, 1tkd:A
14	1sks:A	681	49	0.0720	0.0264	0.3673	7.0	1skr:A, 1skw:A, 1sl1:A, 1sl2:A, 1t7p:A, 1tk5:A, 1x9m:A, 1x9s:A, 1x9w:A, 1zyq:A

[Back]