SKKKLRRMNRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIK
RTGIQEMREALQEKEEQIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKV
PPPWLIAMQRYGPPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTIDRTPWGELE
The query sequence (length=231) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8i0r:2 | 250 | 250 | 1.0000 | 0.9240 | 0.9240 | 6.39e-169 | 8ch6:E, 6ff4:8, 6ff7:8, 8i0p:2, 8i0s:2, 8i0t:2, 8i0u:2, 8i0v:2, 8qo9:B2, 7qtt:E, 6qx9:B2, 8qxd:B2, 8r08:B2, 8r0a:B2, 8r0b:B2 |
2 | 7vpx:2 | 187 | 227 | 0.7835 | 0.9679 | 0.7974 | 1.33e-120 | 7evo:2, 8hk1:2, 7onb:I, 7q4o:B, 7q4p:B, 6y50:8 |
3 | 7dvq:2 | 216 | 242 | 0.8009 | 0.8565 | 0.7645 | 1.13e-118 | 7abh:T, 7abi:T, 8y7e:2, 5z56:2, 5z57:2, 5z58:2 |
4 | 7q3l:B | 110 | 130 | 0.4416 | 0.9273 | 0.7846 | 1.29e-63 | |
5 | 7dco:2 | 220 | 202 | 0.3506 | 0.3682 | 0.4010 | 4.57e-39 | 6g90:Q, 5gm6:H, 5nrl:Q, 5zwm:2 |
6 | 7s7b:F | 352 | 54 | 0.0823 | 0.0540 | 0.3519 | 0.057 | 7s7b:B, 7s7c:B |
7 | 1gxu:A | 88 | 28 | 0.0519 | 0.1364 | 0.4286 | 0.074 | |
8 | 6dbb:A | 504 | 58 | 0.0779 | 0.0357 | 0.3103 | 1.8 | 6dbb:B, 6dbb:C |
9 | 2r02:A | 697 | 73 | 0.0996 | 0.0330 | 0.3151 | 2.0 | 3c3o:A, 3c3q:A, 3c3r:A, 2r03:A, 2r05:A, 5v3r:A, 5wa1:A, 2xs1:A, 2xs8:A |
10 | 5ow0:B | 251 | 26 | 0.0476 | 0.0438 | 0.4231 | 4.1 | |
11 | 6n9u:H | 645 | 49 | 0.0779 | 0.0279 | 0.3673 | 5.4 | 6n9v:H, 6n9w:H, 6n9x:H, 6p7e:D |
12 | 8eew:A | 766 | 66 | 0.0823 | 0.0248 | 0.2879 | 5.9 | 8eew:B, 8eff:A, 8eff:B, 8eff:C, 8eff:D, 8efr:A, 8efr:B, 8efr:C, 8efr:K, 8efr:D, 8efr:L, 8efr:E, 8efr:M, 8efr:F, 8efr:N, 8efr:G, 8efr:O, 8efr:H, 8efr:P, 8efr:I, 8efr:Q, 8efr:J, 8efr:R, 6jtg:A |
13 | 6p7e:C | 672 | 49 | 0.0779 | 0.0268 | 0.3673 | 7.6 | 1sl0:A, 1sl0:C |
14 | 2ajq:A | 704 | 49 | 0.0779 | 0.0256 | 0.3673 | 7.7 | 2ajq:F, 6n7w:H, 6p7e:A, 6p7e:B, 1t8e:A, 1tk0:A, 1tk8:A, 1tkd:A |
15 | 1sks:A | 681 | 49 | 0.0779 | 0.0264 | 0.3673 | 8.5 | 1skr:A, 1skw:A, 1sl1:A, 1sl2:A, 1t7p:A, 1tk5:A, 1x9m:A, 1x9s:A, 1x9w:A, 1zyq:A |
16 | 4pab:B | 824 | 28 | 0.0476 | 0.0133 | 0.3929 | 9.0 | 5l46:A, 5l46:B, 4p9s:A, 4p9s:B, 4paa:A, 4paa:B, 4pab:A |