SKGRKLNYSVQDPIANYEAPITSGYKWSDDQIDEFFAGLLGQ
The query sequence (length=42) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7suk:5 | 296 | 42 | 1.0000 | 0.1419 | 1.0000 | 1.49e-25 | 7ajt:JK, 7d63:RY, 6lqp:RY, 6lqq:RY, 6lqr:RY, 6lqu:RY, 6lqv:RY, 6zqb:JK, 6zqc:JK |
2 | 6rxu:CZ | 44 | 42 | 0.4286 | 0.4091 | 0.4286 | 1.48e-06 | 6rxv:CZ, 6rxz:CZ |
3 | 7mq8:NN | 42 | 42 | 0.3810 | 0.3810 | 0.3810 | 0.002 | 7mq9:NN |
4 | 4xo4:A | 870 | 19 | 0.1905 | 0.0092 | 0.4211 | 1.6 | 3b2p:A, 3b2x:A, 3b34:A, 3b37:A, 3b3b:A, 2dq6:A, 2dqm:A, 6g8b:A, 2hpo:A, 2hpt:A, 3ked:A, 5mfr:A, 5mfs:A, 5mft:A, 3puu:A, 4q4e:A, 4q4i:A, 3qjx:A, 4xmt:A, 4xmu:A, 4xmv:A, 4xmw:A, 4xmx:A, 4xmz:A, 4xn1:A, 4xn2:A, 4xn4:A, 4xn5:A, 4xn7:A, 4xn8:A, 4xn9:A, 4xna:A, 4xnb:A, 4xnd:A, 4xo3:A, 4xo5:A, 5yo1:A, 5yq1:A, 5yq2:A, 5yqb:A, 2zxg:A |
5 | 5ljz:A | 410 | 32 | 0.2857 | 0.0293 | 0.3750 | 2.1 | 5lk1:A |
6 | 5uqd:A | 324 | 16 | 0.1667 | 0.0216 | 0.4375 | 2.8 | |
7 | 7cll:C | 426 | 21 | 0.2381 | 0.0235 | 0.4762 | 2.9 | 7ckp:A, 7clk:A, 7cll:A, 7cll:B, 7cll:D, 7dlr:A, 7e4f:A, 7e51:A, 7e51:B, 7e51:C, 7e51:D, 7e51:E, 7e51:F, 7e51:G, 7e51:H, 6l7d:A |
8 | 7v4w:A | 217 | 25 | 0.2619 | 0.0507 | 0.4400 | 4.8 | 7v64:A, 7v7k:A, 7v8q:A, 7v8q:C, 7v8q:E, 7vac:A, 7vac:C, 7vac:E, 7vaz:C, 7vaz:A, 7vaz:F, 1y0l:L, 1y0l:A, 1y0l:C, 1y18:L, 1y18:A, 1y18:C, 1y18:E |
9 | 7oik:A | 4426 | 30 | 0.2857 | 0.0027 | 0.4000 | 5.0 | 7oim:A, 6tax:A, 6tay:A |
10 | 5ljx:A | 382 | 23 | 0.2381 | 0.0262 | 0.4348 | 7.4 | 5lk2:A, 5lk3:A |
11 | 6m0a:B | 256 | 12 | 0.1905 | 0.0312 | 0.6667 | 7.8 | 6m0a:A, 6m0a:C, 6m0a:D |
12 | 8xfc:D | 517 | 28 | 0.1905 | 0.0155 | 0.2857 | 9.5 | 8wdb:D |
13 | 6ouv:A | 595 | 38 | 0.3095 | 0.0218 | 0.3421 | 10.0 | 2o1x:A, 2o1x:B, 6ouv:B, 8v9i:A, 8v9i:B |