SKFQEIETNLKKLPKLETGFDALANKKKKKNVLPSNDWFTLPKPDDNMRREVQRDLLLIKHRAALDPKRHYKKQRWEVPE
RFAIGTIIEDKSEFYSSRMNRKERKSTILETLMGDEASNKYFKRKYNEIQEKSTSGRKAHYKKMKEMRKKR
The query sequence (length=151) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7d5s:5J | 151 | 151 | 1.0000 | 1.0000 | 1.0000 | 1.96e-109 | 7aju:JM, 7d4i:5J, 7d5t:5J, 7d63:5J, 6ke6:5J, 6lqp:5J, 6lqq:5J, 6lqr:5J, 6lqs:5J, 6lqt:5J, 6lqu:5J, 6lqv:5J, 6zqd:JM, 6zqe:JM |
2 | 7ajt:JM | 135 | 151 | 0.8940 | 1.0000 | 0.8940 | 1.65e-93 | 7suk:SQ, 5wlc:SQ, 6zqa:JM, 6zqb:JM, 6zqc:JM |
3 | 7mqa:SQ | 156 | 140 | 0.3510 | 0.3397 | 0.3786 | 9.25e-22 | |
4 | 6rxt:CT | 131 | 118 | 0.3245 | 0.3740 | 0.4153 | 2.73e-21 | 5oql:k, 6rxu:CT, 6rxv:CT, 6rxx:CT, 6rxy:CT, 6rxz:CT |
5 | 7mq8:SQ | 187 | 126 | 0.3113 | 0.2513 | 0.3730 | 1.46e-20 | 7mq9:SQ |
6 | 3thw:B | 860 | 87 | 0.1589 | 0.0279 | 0.2759 | 0.083 | 8oma:B, 8omo:B, 8omq:B, 3thx:B, 3thy:B, 3thz:B |
7 | 8olx:B | 836 | 87 | 0.1589 | 0.0287 | 0.2759 | 0.089 | 8om5:B, 8om9:B |
8 | 2bfp:D | 257 | 40 | 0.0795 | 0.0467 | 0.3000 | 9.3 | 2bf7:C, 2bf7:D, 2bfa:C, 2bfa:D, 2bfm:C, 2bfm:D, 2bfo:C, 2bfo:D, 2bfp:C, 1e92:D, 5l42:C, 5l42:D, 5l4n:A, 5l4n:B, 7pxx:C, 7pxx:D, 2qhx:C, 6rxc:D, 1w0c:D |
9 | 1zkx:B | 387 | 61 | 0.1126 | 0.0439 | 0.2787 | 9.3 | 1zl6:B, 1zn3:B |