SKFQEIETNLKKLPKLETGFDALANKKKKKNVLPSNDWFTLPKPDDNMRREVQRDLLLIKHRAALDPKRHYKKQRWEVPE
RFAIGTIIEDKMNRKERKSTILETLMGDEASNKYFKRKYNEIQEKSTSGRKAHYKKMKEMRKKR
The query sequence (length=144) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7d5s:5J | 151 | 151 | 1.0000 | 0.9536 | 0.9536 | 4.25e-101 | 7aju:JM, 7d4i:5J, 7d5t:5J, 7d63:5J, 6ke6:5J, 6lqp:5J, 6lqq:5J, 6lqr:5J, 6lqs:5J, 6lqt:5J, 6lqu:5J, 6lqv:5J, 6zqd:JM, 6zqe:JM |
2 | 7ajt:JM | 135 | 144 | 0.9375 | 1.0000 | 0.9375 | 1.84e-94 | 7suk:SQ, 5wlc:SQ, 6zqa:JM, 6zqb:JM, 6zqc:JM |
3 | 6rxt:CT | 131 | 118 | 0.3264 | 0.3588 | 0.3983 | 1.66e-17 | 5oql:k, 6rxu:CT, 6rxv:CT, 6rxx:CT, 6rxy:CT, 6rxz:CT |
4 | 7mqa:SQ | 156 | 140 | 0.3403 | 0.3141 | 0.3500 | 7.62e-16 | |
5 | 7mq8:SQ | 187 | 126 | 0.2986 | 0.2299 | 0.3413 | 9.24e-15 | 7mq9:SQ |
6 | 3thw:B | 860 | 87 | 0.1667 | 0.0279 | 0.2759 | 0.069 | 8oma:B, 8omo:B, 8omq:B, 3thx:B, 3thy:B, 3thz:B |
7 | 8olx:B | 836 | 87 | 0.1667 | 0.0287 | 0.2759 | 0.069 | 8om5:B, 8om9:B |
8 | 1utb:B | 227 | 64 | 0.1181 | 0.0749 | 0.2656 | 0.49 | 1utb:A |