SKEIPTPYMWSYQPQMGLAAGASQDYSSRMNWLSAGPHMIGRVNGIRATRNQILLEQAALTSTPRSQLNPPNWPAAQVYQ
ENPAPTTVLLPRDAEAEVQMTNSGAQLAGRSSFTPRQAYLTLQSSSSQPRSGGIGTLQFVEEFVPSVYFNPFSGAPGLYP
DDFIPNYDAVSESVDGYD
The query sequence (length=178) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6z7n:U | 179 | 179 | 1.0000 | 0.9944 | 0.9944 | 1.71e-128 | 6z7n:T |
2 | 7tau:V | 188 | 187 | 0.8596 | 0.8138 | 0.8182 | 8.74e-110 | |
3 | 6b1t:O | 180 | 180 | 0.8315 | 0.8222 | 0.8222 | 4.66e-108 | |
4 | 7rd1:S | 175 | 178 | 0.8371 | 0.8514 | 0.8371 | 2.95e-107 | |
5 | 7s78:U | 165 | 179 | 0.6629 | 0.7152 | 0.6592 | 5.22e-76 | |
6 | 1bx0:A | 296 | 46 | 0.0730 | 0.0439 | 0.2826 | 5.8 | 1bx1:A, 1fnb:A, 1fnc:A, 1fnd:A, 1frn:A, 1frq:A |
7 | 1jpm:A | 359 | 34 | 0.0787 | 0.0390 | 0.4118 | 7.3 | 1jpm:B, 1jpm:C, 1jpm:D, 1tkk:A, 1tkk:B, 1tkk:C, 1tkk:D, 1tkk:E, 1tkk:F, 1tkk:G, 1tkk:H |
8 | 7qix:G | 261 | 55 | 0.0730 | 0.0498 | 0.2364 | 7.3 | 7qiz:w |