SKDPTTFPLGCSPDITTPKKGLSMELYSYDFRKKGSYPCWDAAYLDPNYPRTGYKSHRLLAKVDGVTGNINFYYHATKGC
TPQLGHLPASYNYPKPLTMTNFTMLLYGYFRPKVTGFHTFTISADDLLFVNFGAGNAFDCCRRDSSADHFGNYQAYAIWG
SKTAKDELTVHLDAGVYYPIRLFYNNREYDGALSFTFKTESNENTVSDFSEYFFSLDDTEEGCPGL
The query sequence (length=226) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6y9j:A | 231 | 226 | 0.9912 | 0.9697 | 0.9912 | 2.55e-169 | 4a3x:A, 4af9:A, 4afa:A, 4afb:A, 4afc:A, 4asl:A, 4d3w:A |
2 | 4coy:A | 232 | 224 | 0.7876 | 0.7672 | 0.7946 | 5.59e-135 | 4cou:A, 4cov:A, 4cow:A, 4coz:A |
3 | 6y98:A | 225 | 218 | 0.4469 | 0.4489 | 0.4633 | 1.02e-61 | 4cp0:A, 4cp1:A, 4cp2:A |
4 | 4gq7:A | 220 | 216 | 0.2522 | 0.2591 | 0.2639 | 5.06e-12 | 4lhk:A, 4lhk:B |
5 | 2xjp:A | 258 | 231 | 0.2788 | 0.2442 | 0.2727 | 7.76e-12 | 4lhn:A, 2xjr:A, 2xjs:A, 2xjt:A, 2xju:A, 2xjv:A |
6 | 6hos:A | 213 | 190 | 0.2478 | 0.2629 | 0.2947 | 8.69e-11 | 6hos:B |
7 | 5a3l:A | 209 | 183 | 0.2257 | 0.2440 | 0.2787 | 1.24e-10 | 5a3l:B, 5a3l:C, 5a3l:D, 5a3m:A, 5a3m:B, 5a3m:C, 5a3m:D |
8 | 3ijh:B | 221 | 89 | 0.1106 | 0.1131 | 0.2809 | 1.8 | 3ijh:D, 3ijs:B, 3ijs:D, 3ijy:B, 3ijy:D, 3ikc:B, 3ikc:D |
9 | 3oke:B | 217 | 68 | 0.0929 | 0.0968 | 0.3088 | 5.3 | 3bpc:B, 4hgw:B, 2r1x:B, 2r1y:B, 2r2b:B, 2r2h:B, 7t0f:H |
10 | 7k84:A | 793 | 42 | 0.0619 | 0.0177 | 0.3333 | 9.7 |