SKAVKYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTFIIGELH
PDDRSKIT
The query sequence (length=88) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1hko:A | 104 | 88 | 1.0000 | 0.8462 | 1.0000 | 4.73e-62 | 1aqa:A, 1cyo:A, 1ehb:A, 1es1:A, 1f03:A, 1f04:A, 1i5u:A, 1ib7:A, 1j0q:A, 1jex:A, 1lqx:A, 1lr6:A, 1m20:A, 1m2i:A, 1m2m:A, 1m59:A, 1nx7:A, 1sh4:A, 1u9m:A, 1u9m:B, 1u9m:C, 1u9m:D, 1u9m:E, 1u9m:F, 1u9u:A, 3x32:A, 3x33:A, 3x34:A, 3x35:A |
2 | 2i96:A | 108 | 86 | 0.9091 | 0.7407 | 0.9302 | 5.20e-57 | 4hin:A, 4hin:B, 4hin:C, 4hin:D, 2m33:A |
3 | 1aw3:A | 94 | 87 | 0.9091 | 0.8511 | 0.9195 | 7.05e-56 | 1axx:A, 2axx:A, 1b5a:A, 1b5b:A, 1bfx:A, 1blv:A, 1do9:A, 1mny:A |
4 | 3ozz:B | 82 | 82 | 0.7955 | 0.8537 | 0.8537 | 1.07e-50 | |
5 | 2i89:A | 90 | 81 | 0.6705 | 0.6556 | 0.7284 | 1.03e-42 | 2i89:B, 2i89:C, 2i89:D, 1icc:A, 1icc:B, 1icc:D, 1lj0:A, 1lj0:B, 1lj0:C, 1lj0:D, 3mus:B |
6 | 1awp:A | 86 | 81 | 0.5682 | 0.5814 | 0.6173 | 3.16e-36 | 1awp:B, 1b5m:A, 1eue:A, 1eue:B, 4hil:A, 4hil:B, 1icc:C, 3mus:A |
7 | 3ner:B | 91 | 81 | 0.5795 | 0.5604 | 0.6296 | 1.87e-35 | 3ner:A |
8 | 2ibj:A | 86 | 85 | 0.5795 | 0.5930 | 0.6000 | 3.41e-33 | |
9 | 4b8n:B | 90 | 74 | 0.3523 | 0.3444 | 0.4189 | 1.53e-13 | 4b8n:A, 4b8n:C, 4b8n:D |
10 | 3lf5:A | 87 | 72 | 0.2841 | 0.2874 | 0.3472 | 2.90e-12 | 3lf5:B |
11 | 1cxy:A | 81 | 80 | 0.2955 | 0.3210 | 0.3250 | 4.61e-12 | |
12 | 1kbi:A | 504 | 51 | 0.2614 | 0.0456 | 0.4510 | 1.67e-11 | 1fcb:A, 1fcb:B, 1kbi:B, 1kbj:A, 1kbj:B, 3ks0:A, 3ks0:B, 1lco:A, 1lco:B, 1ldc:A, 1ltd:A, 1ltd:B, 2oz0:A, 2oz0:B, 1qcw:A, 1qcw:B, 1sze:A, 1sze:B, 1szf:A, 1szf:B, 1szg:A, 1szg:B |
13 | 1x3x:A | 82 | 66 | 0.2955 | 0.3171 | 0.3939 | 1.19e-10 | 1x3x:B |
14 | 8tgb:A | 108 | 76 | 0.2614 | 0.2130 | 0.3026 | 2.67e-10 | 8tgb:B |
15 | 7bwh:A | 88 | 84 | 0.2955 | 0.2955 | 0.3095 | 3.44e-10 | |
16 | 1sox:A | 463 | 81 | 0.3295 | 0.0626 | 0.3580 | 3.86e-07 | 2a9a:A, 2a9a:B, 2a9b:A, 2a9c:A, 2a9c:B, 2a9d:A, 2a9d:B, 3hbp:A, 3hbq:A, 1sox:B |
17 | 1mj4:A | 79 | 73 | 0.2727 | 0.3038 | 0.3288 | 4.03e-06 | |
18 | 1k6m:A | 432 | 48 | 0.1364 | 0.0278 | 0.2500 | 4.8 | 1c7z:A, 1c7z:B, 1c80:A, 1c80:B, 1c81:A, 1fbt:A, 1fbt:B, 1k6m:B, 1tip:A, 1tip:B |
19 | 2d2c:D | 168 | 24 | 0.1250 | 0.0655 | 0.4583 | 4.8 | 2d2c:Q, 2e74:D, 2e75:D, 2e76:D, 4h0l:D, 4h13:D, 4i7z:D, 4pv1:D, 1vf5:D, 1vf5:Q |
20 | 4cc5:A | 308 | 48 | 0.1818 | 0.0519 | 0.3333 | 5.1 | 4cc6:A, 5fpo:A, 5fpr:A |
21 | 5lvf:A | 142 | 24 | 0.1250 | 0.0775 | 0.4583 | 5.3 | 2l0i:A, 5m9d:A |
22 | 8dyu:A | 2562 | 29 | 0.1250 | 0.0043 | 0.3793 | 7.1 | 8dyv:A |
23 | 8fcy:A | 2864 | 29 | 0.1250 | 0.0038 | 0.3793 | 7.5 | 8fd6:A, 8fdt:A |
24 | 8pqw:A | 2892 | 29 | 0.1250 | 0.0038 | 0.3793 | 7.8 | 8pqy:A, 8pqz:A, 8pqz:J |
25 | 5nug:A | 2920 | 29 | 0.1250 | 0.0038 | 0.3793 | 8.0 | 5nug:B |
26 | 7z8g:A | 3047 | 29 | 0.1250 | 0.0036 | 0.3793 | 8.6 | 8fdu:A, 7z8l:f |
27 | 3t58:B | 504 | 32 | 0.1136 | 0.0198 | 0.3125 | 9.1 | 4p2l:A, 4p2l:B, 3t58:A, 3t58:C, 3t58:D, 3t59:A, 3t59:B, 3t59:C, 3t59:D |
28 | 1p5j:A | 319 | 27 | 0.1250 | 0.0345 | 0.4074 | 9.7 | |
29 | 8ptk:f | 4502 | 29 | 0.1250 | 0.0024 | 0.3793 | 9.8 | 8ptk:e |