SKAMYEAKERYAKKKMQENTKIDTLTDEQHDALAQLCAFRHKFHSNKDSLFLSESAFSMQSDENSKLREVGLPTIEWSFY
DNSHIPDDSFREWFNFANYSELSETIGLELDLDDDETYELVYDELYTEAMGEYEELNQDIEKYLRRIDEEHGTQYC
The query sequence (length=156) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6nmc:B | 156 | 156 | 1.0000 | 1.0000 | 1.0000 | 3.89e-115 | 6nmd:B |
2 | 8fmw:AC | 221 | 58 | 0.1090 | 0.0769 | 0.2931 | 0.098 | |
3 | 8om5:A | 828 | 49 | 0.0833 | 0.0157 | 0.2653 | 0.94 | 8omo:A |
4 | 8ag6:A | 896 | 49 | 0.0833 | 0.0145 | 0.2653 | 1.1 | 2o8b:A, 2o8c:A, 2o8d:A, 2o8e:A, 2o8f:A, 8olx:A, 8om9:A, 8oma:A, 8omq:A, 3thw:A, 3thx:A, 3thy:A, 3thz:A |
5 | 2wq5:A | 119 | 39 | 0.0833 | 0.1092 | 0.3333 | 1.4 | 1poa:A, 1pob:A, 1pob:B |
6 | 2rd4:B | 119 | 39 | 0.0833 | 0.1092 | 0.3333 | 1.5 | 1s6b:B |