BioLiP

>protein
SKAASLHWTSERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVHGDALQKAAKAGLLALSALTFAG
LCYFNYHDVGICKAVAMLWKL

The query sequence (length=101) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3abv:D	102	101	0.9604	0.9510	0.9604	1.11e-66	3ae1:D, 3ae2:D, 3ae3:D, 3ae4:D, 3ae5:D, 3ae6:D, 3ae7:D, 3ae8:D, 3ae9:D, 3aea:D, 3aeb:D, 3aec:D, 3aed:D, 3aee:D, 3aef:D, 3aeg:D, 8gs8:D, 3sfd:D, 3sfe:D, 4ytp:D, 4yxd:D, 1zoy:D, 1zp0:D
2	2h89:D	102	101	0.8020	0.7941	0.8020	1.80e-45	2fbw:D, 2fbw:Q, 2h88:D, 2h88:Q, 6myo:D, 6myp:D, 6myq:D, 6myr:D, 6mys:D, 6myt:D, 6myu:D, 2wqy:D, 2wqy:Q, 1yq3:D, 1yq4:D
3	5c2t:D	129	95	0.4356	0.3411	0.4632	3.36e-20	5c2t:H, 5c3j:D, 5c3j:H, 3vr8:D, 3vr8:H, 3vr9:D, 3vr9:H, 3vra:D, 3vra:H, 3vrb:D, 3vrb:H, 4ysx:D, 4ysx:H, 4ysy:D, 4ysy:H, 4ysz:D, 4ysz:H, 4yt0:D, 4yt0:H, 4ytm:D, 4ytm:H, 4ytn:D, 4ytn:H
4	8wbd:B	330	36	0.1287	0.0394	0.3611	0.81	8wbd:C
5	8wbd:b	352	36	0.1287	0.0369	0.3611	0.83
6	8ci0:AAA	666	17	0.0891	0.0135	0.5294	4.5	8ci0:BBB, 8ci0:CCC, 1itz:A, 1itz:B, 1itz:C
7	5nd5:A	669	17	0.0891	0.0135	0.5294	4.8	5nd5:B
8	4v6w:AW	129	33	0.0990	0.0775	0.3030	6.2	6xu6:AW, 6xu7:AW, 6xu8:AW
9	6g79:S	262	26	0.0990	0.0382	0.3846	6.8
10	3fge:A	198	37	0.1188	0.0606	0.3243	9.1
11	7anc:B	314	41	0.1188	0.0382	0.2927	9.5

[Back]