SIYQGGNKLNEDDFRSHVYSLCQLDNVGVLLGAGASVGCGGKTMKDVWKSFKQNYPELLGALIDKYLLVSQIDSDNNLVN
The query sequence (length=384) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
8j4u:B |
401 |
388 |
1.0000 |
0.9576 |
0.9897 |
0.0 |
8j4u:A, 8j4u:C, 8j4u:D, 8j4u:E, 8j4u:F, 8j4u:G, 8j4u:H, 8j4u:I, 8j4u:J, 8j4u:K, 8j4u:L, 8su9:A, 8su9:B, 8su9:C, 8su9:D, 8su9:E, 8su9:F, 8su9:G, 8su9:H, 8su9:I, 8su9:J, 8su9:K, 8su9:L, 8sub:A, 8sub:B, 8sub:C, 8sub:D, 8sub:E, 8sub:F, 8sub:G, 8sub:H, 8sub:I, 8sub:J, 8sub:K, 8sub:L, 8suw:A, 8suw:B, 8suw:C, 8suw:D, 8suw:E, 8suw:F, 8suw:G, 8suw:H, 8suw:I, 8suw:J, 8suw:K, 8suw:L, 8sxx:A, 8sxx:B, 8sxx:C, 8sxx:D, 8sxx:E, 8sxx:F, 8sxx:G, 8sxx:H, 8sxx:I, 8sxx:J, 8sxx:K, 8sxx:L, 8uae:A, 8uae:B, 8uae:C, 8uae:D, 8uae:E, 8uae:F, 8uae:G, 8uae:H, 8uae:I, 8uae:J, 8uae:K, 8uae:L, 8uaf:A, 8uaf:B, 8uaf:C, 8uaf:D, 8uaf:E, 8uaf:F, 8uaf:G, 8uaf:H, 8uaf:I, 8uaf:J, 8uaf:K, 8uaf:L |
2 |
4cqb:A |
402 |
67 |
0.0521 |
0.0498 |
0.2985 |
1.4 |
5akq:A, 5akq:B, 4cqb:B, 4cqc:A, 4cqc:B, 4cqd:A, 4cqd:B, 2qt3:A, 2qt3:B |
3 |
5gm2:K |
267 |
87 |
0.0651 |
0.0936 |
0.2874 |
2.4 |
|
4 |
7prj:A |
55 |
36 |
0.0286 |
0.2000 |
0.3056 |
4.3 |
|
5 |
7dxg:A |
698 |
110 |
0.0703 |
0.0387 |
0.2455 |
5.5 |
7dxf:A, 7dxf:D, 7dxf:B, 7dxf:C, 7dxg:D, 7dxg:C, 7dxg:B |
6 |
3i45:A |
378 |
41 |
0.0365 |
0.0370 |
0.3415 |
5.7 |
|
7 |
5gm2:B |
282 |
87 |
0.0599 |
0.0816 |
0.2644 |
5.9 |
5gm1:A, 5gm1:B, 5gm1:C, 5gm1:D, 5gm1:E, 5gm1:F, 5gm1:G, 5gm1:H, 5gm1:I, 5gm1:J, 5gm1:K, 5gm1:L, 5gm1:M, 5gm1:N, 5gm1:O, 5gm1:P, 5gm1:Q, 5gm1:R, 5gm2:A, 5gm2:C, 5gm2:D, 5gm2:E, 5gm2:F, 5gm2:G, 5gm2:H, 5gm2:I, 5gm2:J, 5gm2:L, 5gm2:M, 5gm2:N, 5gm2:O, 5gm2:P, 5gm2:Q, 5gm2:R |
8 |
4z0x:A |
105 |
38 |
0.0365 |
0.1333 |
0.3684 |
5.9 |
|
9 |
7m4v:Z |
55 |
35 |
0.0365 |
0.2545 |
0.4000 |
7.0 |
7m4w:Z, 7m4x:Z, 7m4y:Z, 7m4z:Z, 7ryf:Z, 7ryg:Z, 7ryh:Z, 7uvv:Z, 7uvw:Z, 7uvx:Z, 7uvy:Z, 7uvz:Z, 7uw1:Z, 6v39:Z, 6v3a:Z, 6v3b:Z, 6v3d:Z, 6yhs:X, 6ysi:X |
10 |
7bv3:B |
439 |
56 |
0.0417 |
0.0364 |
0.2857 |
8.0 |
|