BioLiP

>protein
SIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIA

The query sequence (length=65) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3f21:A	67	65	1.0000	0.9701	1.0000	1.72e-42	2acj:B, 2acj:C, 2acj:D, 3f21:B, 3f21:C, 3f22:A, 3f22:B, 3f22:C, 3f23:A, 3f23:B, 3f23:C, 2gxb:A, 2gxb:B, 3irq:B, 3irq:A, 3irq:D, 3irq:C, 3irr:C, 3irr:D, 3irr:A, 3irr:B, 1qbj:A, 1qbj:B, 1qbj:C, 5zu1:C, 5zu1:A, 5zu1:B, 5zuo:B, 5zuo:C, 5zuo:D, 5zup:B, 5zup:C, 5zup:D
2	2acj:A	53	59	0.7692	0.9434	0.8475	3.57e-28	5zuo:A, 5zup:A
3	5zu1:D	47	59	0.6769	0.9362	0.7458	6.70e-22
4	7c0i:B	67	39	0.3538	0.3433	0.5897	2.39e-09	7c0i:A, 7c0i:C
5	4kmf:A	62	58	0.2615	0.2742	0.2931	4.59e-05
6	1sfu:A	70	46	0.2769	0.2571	0.3913	1.51e-04	1sfu:B
7	7c0j:B	62	30	0.2769	0.2903	0.6000	4.22e-04	7c0j:A
8	2heo:A	59	59	0.3077	0.3390	0.3390	7.46e-04	2heo:D, 1j75:A
9	4lb5:B	63	61	0.2923	0.3016	0.3115	0.018	4lb5:A, 4lb6:B
10	4ev0:D	214	33	0.1846	0.0561	0.3636	0.089	4ev0:A
11	3byr:A	89	29	0.1692	0.1236	0.3793	2.1
12	3qph:A	335	40	0.1846	0.0358	0.3000	4.1	2f5t:X
13	6zj3:LT	190	28	0.1846	0.0632	0.4286	4.8
14	1c3r:A	372	51	0.2923	0.0511	0.3725	5.1	1c3r:B, 1c3s:A
15	8inz:C	465	34	0.1692	0.0237	0.3235	9.9	8inz:A, 8inz:B, 8inz:D, 8io3:C, 8io3:A, 8io3:B, 8io3:D

[Back]