SIVNILSVNVLNNPAKFSDPYKFEITFECLEPLKSDLEWKLTYVGSATSQSYDQILDTLLVGPIPIGINKFVFEADPPNI
DLLPQLSDVLGVTVILLSCAYEDNEFVRVGYYVNNEMEGLNLQEMDDAEIKKVKVDISKVWRSILAEKPRVTRFNIQWDN
The query sequence (length=160) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 2dze:A | 160 | 159 | 0.9938 | 0.9938 | 1.0000 | 3.92e-115 | 2dze:B, 2z34:A, 2z34:B, 2z3f:A, 2z3f:H, 2z3f:B, 2z3f:C, 2z3f:D, 2z3f:E, 2z3f:F, 2z3f:G |
| 2 | 6f0y:A | 172 | 160 | 0.6438 | 0.5988 | 0.6438 | 4.02e-70 | 2ygv:A, 2ygv:D, 2ygv:B, 2ygv:C |
| 3 | 2iij:A | 156 | 158 | 0.5375 | 0.5513 | 0.5443 | 1.21e-57 | 8bv1:A, 8bv1:B, 8bv1:E, 8bv1:F, 8bv1:D, 8bv1:C, 8cj1:B, 8cj1:C, 8cj1:D, 8cj1:E, 8cj1:G, 8cj2:A, 8cj2:B, 8cj2:C, 8cj2:D, 8cj3:A, 6f0f:A, 6f0g:A, 6f0g:B, 6f0h:A, 6f0h:C, 2i32:A, 2i32:B, 7lo0:A, 7lo0:B, 7lo0:C, 7lo0:D, 7lo0:E, 7lo0:F, 7lo0:G, 7lo0:H, 6zuf:A, 6zuf:B |
| 4 | 1qrl:A | 214 | 115 | 0.1812 | 0.1355 | 0.2522 | 5.8 | 3otm:A, 3otz:A, 3ou9:A, 3oup:A, 3ow5:A, 1qq0:A, 1qre:A, 1qrf:A, 1qrg:A, 1qrm:A, 1thj:A, 1thj:B, 1thj:C |
| 5 | 2yb0:E | 264 | 135 | 0.2000 | 0.1212 | 0.2370 | 8.5 | 2cje:A, 2yay:A, 2yaz:A, 2yaz:B, 2yaz:D, 2yaz:E, 2yb0:A, 2yb0:B, 2yb0:D |
| 6 | 4s1b:D | 214 | 44 | 0.0813 | 0.0607 | 0.2955 | 9.2 | 4s1b:A, 4s1c:D, 4s1c:A |
umich.edu