BioLiP

>protein
SISDTQVYIALVVALIPGLLAWRLATELYK

The query sequence (length=30) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6k61:M	31	30	1.0000	0.9677	1.0000	3.05e-15	6jeo:aM, 6jeo:bM, 6jeo:cM, 6jeo:dM, 6k61:m, 7lx0:V, 7lx0:m, 7lx0:M, 6pnj:M, 6pnj:V, 6pnj:m, 6tcl:M1, 6tcl:M2, 6tcl:M, 6tcl:MM, 7y3f:M
2	7qco:T	31	30	0.8333	0.8065	0.8333	2.92e-13	6vpv:M, 6vpv:m, 6vpv:z
3	4fe1:M	31	30	0.6667	0.6452	0.6667	2.23e-10	7fix:M1, 7fix:M2, 7fix:M3, 1jb0:M, 6k33:aM, 6k33:bM, 6k33:cM, 6lu1:M, 7m75:M, 7m76:M, 3pcq:M, 6pfy:M, 6pfy:V, 6pfy:i, 6pgk:M, 6pgk:V, 6tra:M, 6trc:M, 6trc:m, 6trc:y, 6trd:m, 6trd:y, 5zf0:M1, 5zf0:M2, 5zf0:M3, 5zf0:M4, 5zf0:M6, 5zf0:M5
4	6kmw:aM	31	30	0.6333	0.6129	0.6333	3.03e-10	6kmw:bM, 6kmw:cM, 6kmx:aM, 6kmx:bM, 6kmx:cM
5	7s3d:M	31	30	0.6667	0.6452	0.6667	6.39e-10	7s3d:V, 7s3d:m
6	8am5:m	31	30	0.6667	0.6452	0.6667	4.67e-09	8asl:m, 8asp:m, 6hqb:M, 4kt0:M, 4l6v:M, 4l6v:m, 4l6v:7, 6nwa:M, 6nwa:m, 6nwa:V, 7o1v:M, 5oy0:M, 5oy0:m, 5oy0:9, 7umh:M, 7umh:V, 7umh:m, 6uzv:M, 6uzv:m, 6uzv:9
7	7yca:M	31	29	0.6333	0.6129	0.6552	8.30e-08
8	6igz:M	31	30	0.5333	0.5161	0.5333	3.40e-06
9	7xqp:M	32	30	0.5667	0.5312	0.5667	5.35e-06	8htu:M, 7ksq:M, 7kux:M
10	8wm6:M	30	29	0.5333	0.5333	0.5517	4.38e-05	8wmj:M, 8wmv:M, 8wmw:M, 7y7b:M, 7y8a:M
11	6l4u:M	30	29	0.5333	0.5333	0.5517	9.04e-05
12	7a4p:M	31	29	0.5000	0.4839	0.5172	0.001	6zzx:M, 6zzy:M
13	7y5e:MN	30	28	0.5667	0.5667	0.6071	0.48	7y5e:M2, 7y7a:M7, 7y7a:Mo
14	4uw9:A	228	18	0.2667	0.0351	0.4444	4.3
15	3pzi:A	357	27	0.3333	0.0280	0.3704	5.3	3pzo:A, 3pzq:A
16	7pub:FO	267	28	0.3333	0.0375	0.3571	9.4
17	7pua:FO	328	28	0.3333	0.0305	0.3571	9.4	6sga:FO, 6sgb:FO

[Back]