BioLiP

>protein
SISDSQIIVALVSAFITGILALRLGKSLYQ

The query sequence (length=30) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7xqp:M	32	30	1.0000	0.9375	1.0000	3.55e-14	8htu:M, 7ksq:M, 7kux:M
2	7qco:T	31	30	0.6000	0.5806	0.6000	1.44e-06	6vpv:M, 6vpv:m, 6vpv:z
3	8wm6:M	30	29	0.5333	0.5333	0.5517	3.43e-06	8wmj:M, 8wmv:M, 8wmw:M, 7y7b:M, 7y8a:M
4	7yca:M	31	30	0.5667	0.5484	0.5667	3.55e-06
5	6igz:M	31	30	0.6000	0.5806	0.6000	4.14e-06
6	6k61:M	31	30	0.5667	0.5484	0.5667	6.22e-06	6jeo:aM, 6jeo:bM, 6jeo:cM, 6jeo:dM, 6k61:m, 7lx0:V, 7lx0:m, 7lx0:M, 6pnj:M, 6pnj:V, 6pnj:m, 6tcl:M1, 6tcl:M2, 6tcl:M, 6tcl:MM, 7y3f:M
7	7s3d:M	31	30	0.5667	0.5484	0.5667	2.59e-05	7s3d:V, 7s3d:m
8	6l4u:M	30	29	0.5000	0.5000	0.5172	1.50e-04
9	6kmw:aM	31	30	0.4667	0.4516	0.4667	2.54e-04	6kmw:bM, 6kmw:cM, 6kmx:aM, 6kmx:bM, 6kmx:cM
10	7a4p:M	31	30	0.5000	0.4839	0.5000	3.27e-04	6zzx:M, 6zzy:M
11	8am5:m	31	30	0.4667	0.4516	0.4667	5.61e-04	8asl:m, 8asp:m, 6hqb:M, 4kt0:M, 4l6v:M, 4l6v:m, 4l6v:7, 6nwa:M, 6nwa:m, 6nwa:V, 7o1v:M, 5oy0:M, 5oy0:m, 5oy0:9, 7umh:M, 7umh:V, 7umh:m, 6uzv:M, 6uzv:m, 6uzv:9
12	4fe1:M	31	30	0.4333	0.4194	0.4333	6.05e-04	7fix:M1, 7fix:M2, 7fix:M3, 1jb0:M, 6k33:aM, 6k33:bM, 6k33:cM, 6lu1:M, 7m75:M, 7m76:M, 3pcq:M, 6pfy:M, 6pfy:V, 6pfy:i, 6pgk:M, 6pgk:V, 6tra:M, 6trc:M, 6trc:m, 6trc:y, 6trd:m, 6trd:y, 5zf0:M1, 5zf0:M2, 5zf0:M3, 5zf0:M4, 5zf0:M6, 5zf0:M5
13	7y5e:MN	30	28	0.5333	0.5333	0.5714	0.045	7y5e:M2, 7y7a:M7, 7y7a:Mo

[Back]