SIRIFPRIAGRSYIIYGQTSGIICKRMEKSDNEFVIYNYISEHYDKFLKKYVPKLYGKNNDMLLLEDLTYNYNNPNVMDV
KIGARKRKSHTSGFFSIRGYTNSHDYKFDPDEYLTSESTINHIKNFMEAGGENRDKTKQVLLKWIMKLSELANDLFEINL
KFDGVSLIFIYDDDCSKCDVNVVDFSRVKLIDTNDQMTISAVTNLIKILSELADNP
The query sequence (length=216) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8t8z:A | 217 | 216 | 1.0000 | 0.9954 | 1.0000 | 6.68e-161 | 8t8u:A, 8t8v:A, 8t8w:A, 8t8x:A, 8t8y:A, 8t90:A, 8t91:A, 8t92:A, 8t93:A, 8t95:A, 8t96:A, 8t97:A |
2 | 5w2i:A | 239 | 241 | 0.3009 | 0.2720 | 0.2697 | 8.94e-12 | 6m88:A, 6m89:A, 6m8a:A, 6m8b:A, 6m8c:A, 6m8d:A, 6m8e:A, 5w2h:A |
3 | 8ppg:B | 243 | 243 | 0.2454 | 0.2181 | 0.2181 | 0.001 | |
4 | 8ppb:A | 276 | 71 | 0.0926 | 0.0725 | 0.2817 | 0.11 | 8pp8:A, 8pp8:B, 8pp9:A, 8pp9:B, 8ppa:A, 8ppa:B, 8ppb:B, 8ppc:A, 8ppc:B, 8ppd:A, 8ppd:B, 8ppe:A, 8ppe:B, 8ppf:A, 8ppf:B, 8ppg:A, 8pph:A, 8pph:B, 8ppi:A, 8ppi:B, 8ppj:A, 8ppj:B, 1tzd:A, 1tzd:B, 1w2c:A, 1w2c:B, 1w2d:A, 1w2d:B |
5 | 2a98:A | 259 | 46 | 0.0741 | 0.0618 | 0.3478 | 0.19 | |
6 | 2iew:A | 258 | 42 | 0.0694 | 0.0581 | 0.3571 | 0.26 | 2if8:A |
7 | 4fxq:A | 445 | 97 | 0.1481 | 0.0719 | 0.3299 | 0.31 | 4fk7:A, 4fxq:B |
8 | 4o4e:A | 246 | 49 | 0.0694 | 0.0610 | 0.3061 | 0.60 | 4o4d:A, 4o4f:A, 8omi:A |
9 | 2aqx:A | 289 | 42 | 0.0648 | 0.0484 | 0.3333 | 4.1 | 2aqx:B |
10 | 7ns3:4 | 199 | 15 | 0.0509 | 0.0553 | 0.7333 | 4.5 | |
11 | 4bp9:A | 710 | 70 | 0.0972 | 0.0296 | 0.3000 | 4.6 | 4bp9:B, 4bp9:C, 4bp9:D, 4bp9:E, 4bp9:F |
12 | 1wdq:A | 493 | 90 | 0.1019 | 0.0446 | 0.2444 | 9.0 | 1bfn:A, 1btc:A, 1byb:A, 1byc:A, 1byd:A, 1q6c:A, 1q6d:A, 1q6e:A, 1q6f:A, 1q6g:A, 1v3h:A, 1v3i:A, 1wdr:A, 1wds:A |