BioLiP

>protein
SINLHSAPEYDPSYKLIQLTPELLDIIQDPVQNHQLRFKSLDKDKSEVVLCSHDKTWVLKQRKHSNTVLLMREFVPEQPI
TFDETLLFGLSKPYMDVVGFAKTESEFETRETHGMDPKERFKVLFRLQSQWDLEDIKPLIEELNSRGMKIDSFIMKYARR
KRLGKKTVVTS

The query sequence (length=171) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8twa:B	171	171	1.0000	1.0000	1.0000	1.46e-126
2	6s1c:F	299	114	0.6667	0.3813	1.0000	1.13e-79
3	6s1c:F	299	72	0.3567	0.2040	0.8472	1.97e-33
4	6s1c:B	342	114	0.6667	0.3333	1.0000	6.37e-79
5	6s1c:B	342	72	0.3567	0.1784	0.8472	5.20e-33
6	5okc:B	377	114	0.6667	0.3024	1.0000	1.49e-78	5msm:A, 5msm:D, 5okc:A, 5oki:C, 5oki:G, 6s2e:B, 6s2f:B, 8tw9:B
7	5okc:B	377	66	0.3392	0.1538	0.8788	1.29e-32	5msm:A, 5msm:D, 5okc:A, 5oki:C, 5oki:G, 6s2e:B, 6s2f:B, 8tw9:B
8	4zlf:A	785	33	0.0819	0.0178	0.4242	0.26	4zlg:A, 4zli:A
9	2db3:A	420	144	0.2222	0.0905	0.2639	0.55	2db3:B, 2db3:C, 2db3:D
10	7ea4:A	762	74	0.1170	0.0262	0.2703	0.66	7ea4:B, 7eby:A, 7eby:B, 7eby:C, 7eby:D, 7eby:E, 7eby:F
11	1jer:A	110	59	0.0936	0.1455	0.2712	0.72
12	3orf:A	230	21	0.0585	0.0435	0.4762	0.94	3orf:B, 3orf:C, 3orf:D
13	7cww:A	350	49	0.0994	0.0486	0.3469	2.2
14	3vtf:A	432	52	0.0877	0.0347	0.2885	3.7
15	4fey:A	392	45	0.0760	0.0332	0.2889	4.1
16	1e3a:B	560	70	0.0994	0.0304	0.2429	7.2	1ai4:B, 1ai5:B, 1ai6:B, 1ai7:B, 1ajn:B, 1ajp:B, 1ajq:B, 1fxh:B, 1fxv:B, 1gk9:B, 1gkf:B, 1gm7:B, 1gm8:B, 1gm9:B, 1h2g:B, 1jx9:B, 1k5q:B, 1k5s:B, 1k7d:B, 1kec:B, 1pnk:B, 1pnl:B, 1pnm:B

[Back]