BioLiP

>protein
SIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQ
QALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAA
SREDLALCPGLGPQKARRLFDVLHEPFLKVP

The query sequence (length=191) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6sxb:G	191	191	1.0000	1.0000	1.0000	2.93e-142	2jnw:A
2	2bgw:A	219	56	0.0733	0.0639	0.2500	0.003
3	8ak4:A	513	86	0.1361	0.0507	0.3023	0.003
4	3c1y:A	349	63	0.1099	0.0602	0.3333	0.17	3c1y:B, 3c21:A, 3c21:B, 3c23:A, 3c23:B, 4yvz:A, 4yvz:B, 4yxj:A, 4yxj:B, 4yxm:A, 4yxm:B
5	7ti7:A	442	26	0.0628	0.0271	0.4615	3.0
6	3ai2:A	263	29	0.0681	0.0494	0.4483	3.4	3ai2:B, 3ai2:H, 3ai2:D, 3ai2:E, 3ai2:C, 3ai2:F, 3ai2:G, 3ai3:A, 3ai3:C, 3ai3:E, 3ai3:G
7	2owo:A	586	37	0.0733	0.0239	0.3784	3.6	4glx:A, 5tt5:A
8	1j04:A	387	51	0.0942	0.0465	0.3529	3.7	4cbr:A, 4cbs:A, 5f9s:A, 5f9s:B, 1h0c:A, 5hhy:A, 5hhy:B, 5luc:A, 5luc:B, 5luc:E, 5luc:G, 5luc:M, 5luc:N, 5luc:S, 5luc:T, 5ofy:A, 5og0:A, 6rv0:A, 6rv1:A, 2yob:A, 2yob:B
9	4qdk:A	219	108	0.1466	0.1279	0.2593	5.5	4qdj:A, 4qdk:B
10	8dzr:A	258	70	0.0890	0.0659	0.2429	5.9
11	4djh:B	448	70	0.0890	0.0379	0.2429	6.4	4djh:A
12	5lum:A	78	33	0.0576	0.1410	0.3333	7.0	5lum:B, 5lum:D, 5lum:C, 5lum:E
13	5xte:J	378	54	0.0733	0.0370	0.2593	7.1	5xte:V, 5xth:AJ, 5xth:AV, 5xti:AJ, 5xti:AV

[Back]