SIEIPLHEIIRKLERMNQKKQAQRKRHKLNRKERGHKSPSEQRRSELWHARQVELS
The query sequence (length=56) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2zi0:A | 60 | 54 | 0.9643 | 0.9000 | 1.0000 | 1.07e-32 | 3cz3:A, 3cz3:B, 3cz3:D, 3cz3:C, 2zi0:B |
2 | 6o0y:A | 1146 | 58 | 0.3036 | 0.0148 | 0.2931 | 0.38 | |
3 | 6bzo:F | 326 | 20 | 0.1786 | 0.0307 | 0.5000 | 1.2 | 6c04:F, 6cce:F, 6ccv:F, 6dcf:F, 6edt:F, 6ee8:F, 6eec:F, 6fbv:F, 8hih:F, 7kif:F, 7kim:F, 7kin:F, 6m7j:F, 6ono:B, 6ono:D, 6onu:B, 6onu:D, 6onu:F, 6onu:H, 7p5x:AF, 5tw1:F, 7u22:F, 5uh5:F, 5uh6:F, 5uh8:F, 5uh9:F, 5uha:F, 5uhb:F, 5uhc:F, 5uhd:F, 5uhe:F, 5uhf:F, 5uhg:F, 5vi5:F, 5vi8:F, 6vvs:F, 6vvt:F, 6vvv:F, 6vvx:F, 6vvy:F, 6vvz:F, 6vw0:F |