SIEDIVFEKFQPYINWSIDKLCEHFSINKGEKGLNYRIASAILNLKGKTTKSKPFPEVEEFEKSSIVVKTVHFNKKNVNK
ESMSFGAFKFEELANEEWEDSEGYPSAQWRNFLLETRFLFFVVKEDEDGVDIFKGIKFFSMPEEDINGPVKRMWDDTVKK
LKEGVTLEAVPDKSTKDGWRIKNNFVDKSDDLICHVRPHTNNRDYRGGSNADKLPKKINWINRPDSDDYSDEWMTKQSFW
INNDYIKKQVEDLL
The query sequence (length=254) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4pxg:A | 466 | 254 | 1.0000 | 0.5451 | 1.0000 | 0.0 | 2reu:A, 7xm0:A, 7xm0:B, 7xm0:C |
2 | 4nap:D | 310 | 138 | 0.1417 | 0.1161 | 0.2609 | 0.33 | 4nap:A, 4nap:B, 4nap:C, 4pgn:A, 4pgn:B, 4pgn:C, 4pgn:D, 4pgp:A, 4pgp:B, 4pgp:C, 4pgp:D |
3 | 4r78:A | 287 | 130 | 0.1417 | 0.1254 | 0.2769 | 4.2 | 4r7b:A, 4r7b:B |
4 | 3a27:A | 219 | 35 | 0.0472 | 0.0548 | 0.3429 | 4.3 | |
5 | 4d0l:E | 479 | 52 | 0.0551 | 0.0292 | 0.2692 | 9.8 | 5c4g:E, 4d0l:A, 4d0l:C, 4d0m:A, 4d0m:C, 4d0m:G, 4d0m:I, 4d0m:M, 4d0m:O, 4d0m:Q, 4d0m:S, 4d0m:W, 4d0m:Y, 4d0m:c, 4d0m:g, 5euq:E, 5fbl:A, 5fbq:A, 5fbr:A, 5fbv:A, 5fbw:A, 6gl3:A, 8q6f:A, 8q6g:A, 8q6h:A, 8vof:A, 4wae:A, 4wag:A |