SHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLL
The query sequence (length=39) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5kn5:C | 40 | 39 | 1.0000 | 0.9750 | 1.0000 | 3.51e-24 | 5kn5:F |
2 | 8em4:A | 3818 | 29 | 0.3333 | 0.0034 | 0.4483 | 0.017 | 8em4:B |
3 | 8em7:A | 4378 | 29 | 0.3333 | 0.0030 | 0.4483 | 0.017 | 8em7:B, 8jut:A, 8jut:B, 8juu:B, 8juu:A, 8jx8:B, 8jx8:A, 8jx9:B, 8jxa:A, 8jxb:A, 8jxd:A, 8jxe:A, 8jxe:B, 8jxf:B, 8jxg:A, 8jxh:A, 8jxi:B |
4 | 8jxj:A | 570 | 29 | 0.3077 | 0.0211 | 0.4138 | 0.043 | 8jxj:B |
5 | 7pgn:B | 438 | 16 | 0.2051 | 0.0183 | 0.5000 | 1.2 | 7pgm:B, 7pgn:A, 2wfx:B |
6 | 6a5n:A | 502 | 13 | 0.2051 | 0.0159 | 0.6154 | 2.2 | |
7 | 6a5m:A | 488 | 13 | 0.2051 | 0.0164 | 0.6154 | 2.4 | 6a5k:A |
8 | 2hox:B | 427 | 20 | 0.1795 | 0.0164 | 0.3500 | 2.7 | 2hor:A, 2hox:C, 2hox:A, 2hox:D, 1lk9:B, 1lk9:A |
9 | 4pe8:A | 260 | 25 | 0.2821 | 0.0423 | 0.4400 | 3.9 | 1xwy:A |
10 | 7zke:E | 1623 | 24 | 0.2821 | 0.0068 | 0.4583 | 4.2 | |
11 | 5u89:A | 1039 | 23 | 0.1795 | 0.0067 | 0.3043 | 4.9 | |
12 | 5b4x:A | 710 | 32 | 0.2564 | 0.0141 | 0.3125 | 5.8 | 3a7q:A, 5b4x:C, 2e26:A |
13 | 3h9u:C | 435 | 18 | 0.2564 | 0.0230 | 0.5556 | 8.2 | 3h9u:A, 3h9u:B, 3h9u:D |
14 | 3dcp:A | 277 | 10 | 0.1795 | 0.0253 | 0.7000 | 9.2 | 3dcp:B, 3dcp:C, 6nlr:A, 6nlr:B, 6nlr:C |