SHSGVNQLGGVFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILGRYYATGSIRPRAIGGSKPRVATPEV
VSKIAQYKQECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ
The query sequence (length=133) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6pax:A | 133 | 133 | 1.0000 | 1.0000 | 1.0000 | 1.54e-95 | |
2 | 1k78:A | 124 | 123 | 0.7143 | 0.7661 | 0.7724 | 1.17e-68 | 1k78:I, 1k78:E, 1mdm:A |
3 | 1pdn:C | 123 | 120 | 0.5639 | 0.6098 | 0.6250 | 2.77e-52 | |
4 | 4q0z:A | 322 | 38 | 0.0827 | 0.0342 | 0.2895 | 2.5 | 4q0w:A, 4q0z:B, 4q0z:E, 4q0z:F |
5 | 7x2b:A | 217 | 40 | 0.1053 | 0.0645 | 0.3500 | 4.5 | |
6 | 8dhl:B | 853 | 19 | 0.0827 | 0.0129 | 0.5789 | 5.7 | 8dhl:A |
7 | 5mdn:A | 761 | 46 | 0.0902 | 0.0158 | 0.2609 | 9.7 | 5mdn:B |
8 | 3iu7:A | 284 | 21 | 0.0827 | 0.0387 | 0.5238 | 10.0 | 4iec:A, 4if7:A, 3iu8:A, 3iu9:A, 4ook:A, 3pka:A, 3pkb:A, 3pkc:A, 3pkd:A, 3pke:A, 3ror:A, 1yj3:A, 5yoh:A, 5yoi:A, 5ypd:A, 5ypj:A, 5yxf:A |