SHQYELLKHAENLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTKPIKCSA
PKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQ
EFNLIDRRELAPLQELIEKLTS
The query sequence (length=182) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5brk:A | 194 | 182 | 0.9231 | 0.8660 | 0.9231 | 3.05e-124 | 5b5v:A, 5b5v:C, 5b5v:B, 5b5v:D, 5b5w:A, 5b6b:A, 5b6b:B, 5b6b:D, 5b6b:F, 5b6b:H, 5b6b:K, 5b6b:M, 5b6b:O, 5brm:A, 5brm:B, 5brm:C, 5brm:D, 5brm:E, 5brm:F, 4j1v:A, 4j1v:C, 4jiz:A, 6mcp:B, 6mcp:D, 6mcq:B, 6mcq:D, 1pi1:A, 5twf:A, 5twf:B, 5twg:A, 5twh:A, 5xqz:A, 5xqz:B |
2 | 2hjn:A | 206 | 169 | 0.5110 | 0.4515 | 0.5503 | 4.87e-64 | 5ncn:A |
3 | 5ncm:A | 183 | 169 | 0.3956 | 0.3934 | 0.4260 | 1.25e-50 | |
4 | 7k36:H | 177 | 152 | 0.1923 | 0.1977 | 0.2303 | 8.04e-05 | |
5 | 5yf4:A | 129 | 143 | 0.1593 | 0.2248 | 0.2028 | 0.012 | |
6 | 6iaa:A | 815 | 47 | 0.0714 | 0.0160 | 0.2766 | 1.8 | 6iaa:B |
7 | 1rv3:B | 466 | 60 | 0.0769 | 0.0300 | 0.2333 | 4.0 | 1cj0:A, 1ls3:A, 1ls3:B, 1ls3:C, 1ls3:D, 1rv3:A, 1rv4:A, 1rv4:B, 1rvu:A, 1rvu:B, 1rvy:A, 1rvy:B |
8 | 6c0f:D | 190 | 132 | 0.1593 | 0.1526 | 0.2197 | 4.8 | 6cb1:D, 8e5t:D, 6em1:3, 6em3:3, 6em4:3, 6em5:3, 7ohs:3, 7ohw:3, 7ohx:3, 8v83:R, 8v84:R, 5z3g:Z |
9 | 5yj7:C | 490 | 100 | 0.1099 | 0.0408 | 0.2000 | 4.9 | |
10 | 1gl3:A | 367 | 86 | 0.1099 | 0.0545 | 0.2326 | 5.6 | 1gl3:B |
11 | 4zto:L | 216 | 38 | 0.0714 | 0.0602 | 0.3421 | 7.6 | 4zto:M |
12 | 4z7k:B | 195 | 85 | 0.1264 | 0.1179 | 0.2706 | 9.3 | |
13 | 2vea:A | 500 | 42 | 0.0714 | 0.0260 | 0.3095 | 9.3 |