BioLiP

>protein
SHQYELLKHAEADGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTPIKC
SAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFF
VQEFNLIDRRELAPLQELIEKLTS

The query sequence (length=184) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5brk:A	194	181	0.9239	0.8763	0.9392	4.01e-128	5b5v:A, 5b5v:C, 5b5v:B, 5b5v:D, 5b5w:A, 5b6b:A, 5b6b:B, 5b6b:D, 5b6b:F, 5b6b:H, 5b6b:K, 5b6b:M, 5b6b:O, 5brm:A, 5brm:B, 5brm:C, 5brm:D, 5brm:E, 5brm:F, 4j1v:A, 4j1v:C, 4jiz:A, 6mcp:B, 6mcp:D, 6mcq:B, 6mcq:D, 1pi1:A, 5twf:A, 5twf:B, 5twg:A, 5twh:A, 5xqz:A, 5xqz:B
2	2hjn:A	206	173	0.5054	0.4515	0.5376	4.00e-63	5ncn:A
3	5ncm:A	183	177	0.3967	0.3989	0.4124	1.47e-51
4	7k36:H	177	151	0.1957	0.2034	0.2384	9.15e-06
5	5yf4:A	129	143	0.1630	0.2326	0.2098	0.043
6	6c0f:D	190	131	0.1576	0.1526	0.2214	2.2	6cb1:D, 8e5t:D, 6em1:3, 6em3:3, 6em4:3, 6em5:3, 7ohs:3, 7ohw:3, 7ohx:3, 8v83:R, 8v84:R, 5z3g:Z
7	7bjt:A	727	136	0.1630	0.0413	0.2206	2.5	7bjt:B, 7bm6:A, 7bm6:B
8	2ycb:B	635	102	0.1359	0.0394	0.2451	3.6	2ycb:A
9	1rv3:B	466	60	0.0761	0.0300	0.2333	4.2	1cj0:A, 1ls3:A, 1ls3:B, 1ls3:C, 1ls3:D, 1rv3:A, 1rv4:A, 1rv4:B, 1rvu:A, 1rvu:B, 1rvy:A, 1rvy:B
10	8jb1:A	468	57	0.0978	0.0385	0.3158	4.3	8jb1:B
11	4d5e:B	587	32	0.0652	0.0204	0.3750	6.5	4d5e:A, 4d5g:A, 4d5g:B, 2pgn:A, 2pgn:B, 2pgo:A, 2pgo:B
12	2vea:A	500	42	0.0707	0.0260	0.3095	8.7

[Back]