SHPGEMIARDLEDMGVSGRRFAHNIGVTPATVSRLLAGKTALTPSLSIRIAAALGSTPEFWLRLQSNYDLRQLENQIDTS
GIVLYG
The query sequence (length=86) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6chv:D | 91 | 86 | 1.0000 | 0.9451 | 1.0000 | 5.90e-60 | 6chv:A, 6chv:C, 6chv:B, 6chv:G, 6chv:H |
2 | 2icp:A | 87 | 79 | 0.3837 | 0.3793 | 0.4177 | 5.38e-21 | |
3 | 6fix:B | 99 | 76 | 0.3256 | 0.2828 | 0.3684 | 3.62e-14 | 6fix:A, 6fix:D, 6fix:E |
4 | 7csy:B | 97 | 87 | 0.2791 | 0.2474 | 0.2759 | 1.19e-06 | 7csw:B, 7csy:A, 7csy:C, 7csy:D, 6jpi:A, 6jpi:B, 6jpi:C, 6jpi:D, 6lb3:A, 6lb3:B, 6lb3:G, 6lb3:H, 6lb3:C, 6lb3:D, 6lb3:E, 6lb3:F |
5 | 8kdb:A | 2117 | 71 | 0.3140 | 0.0128 | 0.3803 | 0.42 | 8kdc:A |
6 | 8tac:B | 66 | 52 | 0.1628 | 0.2121 | 0.2692 | 0.45 | |
7 | 8q4s:A | 295 | 33 | 0.1744 | 0.0508 | 0.4545 | 0.46 | 7qpl:A |
8 | 2or1:L | 63 | 50 | 0.1628 | 0.2222 | 0.2800 | 3.5 | 2or1:R, 1per:L, 1per:R, 1rpe:L, 1rpe:R |
9 | 6qyi:B | 520 | 53 | 0.1860 | 0.0308 | 0.3019 | 5.9 | 6b1b:A, 6b1b:B, 6eb0:C, 6qyh:B, 6qyi:A |
10 | 4icm:A | 335 | 60 | 0.1860 | 0.0478 | 0.2667 | 5.9 | 4icm:B, 4icm:C, 4icm:D, 4icm:E, 4icm:F, 4icm:G, 4icm:H, 4l6d:A, 4l6d:B, 4l6d:C, 4l6d:D, 4l6d:E, 4l6d:F, 4l6d:G, 4l6d:H, 4ng3:A, 4ng3:B, 4ng3:C, 4ng3:D, 4ng3:E, 4ng3:F, 4ng3:G, 4ng3:H, 4ni8:A, 4ni8:B, 4ni8:C, 4ni8:D, 4ni8:E, 4ni8:F, 4ni8:G, 4ni8:H |
11 | 7yzt:A | 306 | 64 | 0.2209 | 0.0621 | 0.2969 | 6.0 | 7yzt:B, 7yzt:C |
12 | 3h4i:A | 392 | 46 | 0.2209 | 0.0485 | 0.4130 | 8.7 | 3h4t:A |
13 | 5lmx:B | 1115 | 82 | 0.2209 | 0.0170 | 0.2317 | 8.7 | |
14 | 5m5w:B | 1183 | 82 | 0.2209 | 0.0161 | 0.2317 | 8.8 | 4c2m:B, 4c2m:Q, 4c3h:B, 4c3i:B, 4c3j:B, 5g5l:B, 6h67:B, 6h68:B, 6hko:B, 6hlq:B, 6hlr:B, 5m3f:B, 5m3m:B, 5m5x:B, 5m5y:B, 5m64:B, 5n5y:B, 5n5z:B, 5n60:B, 5n61:B, 5oa1:B, 6rqh:B, 6rql:B, 6rqt:B, 6rrd:B, 6rui:B, 6ruo:B, 6rwe:B, 6tps:B, 5w5y:B, 5w64:B, 5w65:B, 5w66:B, 4ym7:AB, 4ym7:BB, 4ym7:CB, 4ym7:DB, 4ym7:EB, 4ym7:FB |