SHPALTQLRALRYSKEIPALDPQLLDWLLLEDSMTKRFEQQGKTVSVTMIREGFVEQNEIPEELPLLPKESRYWLREILL
SADGEPWLAGRTVVPVSTLSGPELALQKLGKTPLGRYLFTSSTLTRDFIEIGRDAGLWGRRSRLRLSGKPLLLTELFLPA
SPLY
The query sequence (length=164) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2ahc:A | 164 | 164 | 1.0000 | 1.0000 | 1.0000 | 9.49e-115 | 2ahc:B, 2ahc:C, 2ahc:D, 1xlr:A |
2 | 6s47:Bi | 952 | 54 | 0.0854 | 0.0147 | 0.2593 | 3.1 | |
3 | 5mil:A | 157 | 38 | 0.0793 | 0.0828 | 0.3421 | 4.9 | 5mil:B |
4 | 7esr:A | 378 | 54 | 0.1098 | 0.0476 | 0.3333 | 5.4 |