BioLiP

>protein
SHMRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKALENRTCHWGFDSANWRAYILLSQDYTGKE
EQARLGRCLDDVKEKFD

The query sequence (length=97) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1mr1:C	97	97	1.0000	1.0000	1.0000	3.24e-71	1mr1:D
2	5c4v:B	96	95	0.4845	0.4896	0.4947	1.19e-32	5c4v:D, 5c4v:F
3	6kwy:c	1811	38	0.1443	0.0077	0.3684	0.76	8cvs:c, 6kwx:A, 7naq:c
4	6rey:c	1773	38	0.1443	0.0079	0.3684	0.79	6rey:d
5	4bas:A	172	39	0.1031	0.0581	0.2564	1.2
6	6hif:G	531	50	0.1546	0.0282	0.3000	1.7	6hif:I, 6hif:H, 6hif:A, 6hif:C, 6hif:B, 6hif:D, 6hif:F, 6hif:E, 6hif:J, 6hif:L, 6hif:K, 6hif:M, 6hif:O, 6hif:N, 6hif:P, 6hif:R, 6hif:Q, 6hif:S, 6hif:U, 6hif:T, 6hif:V, 6hif:X, 6hif:W
7	6i0x:B	422	78	0.2165	0.0498	0.2692	2.4	5ak7:A, 5ak8:A, 6i0x:A, 4ytb:A, 4ytg:A
8	2fgy:A	471	21	0.1134	0.0234	0.5238	2.4	2fgy:B
9	4hcy:A	352	22	0.1031	0.0284	0.4545	3.0	4hcy:B, 4hcy:C, 4hcy:D, 4hcy:E, 4hcy:F
10	5anb:K	1120	15	0.0928	0.0080	0.6000	4.3	5anc:K
11	6m0q:A	504	31	0.1340	0.0258	0.4194	5.3	4fas:A, 4fas:C, 4fas:B, 1fgj:A, 1fgj:B, 6m0p:A, 6m0p:C, 6m0p:E, 6m0q:C, 6m0q:E, 6m0q:G, 6m0q:I, 6m0q:K, 4n4n:A, 4n4n:C, 4n4n:E, 4n4o:A, 4n4o:C, 4n4o:E

[Back]