BioLiP

>protein
SHMREIIERVKEKTTIPVYERTIENVLSAIQASGDVWRIVDLSEEPLPLVVAVVTALYELGYVAFENNQVILTRKGKELV
EKYGIGPRADYTCSHCQGRTVEIDAFSELLEQFKEITRDRPEPAHQFDQAYVTPETTVARVALMHSRGDLENKEVFVLGD
DDLTSVALMLSGLPKRIAVLDIDERLTKFIEKAADEIGYENIEIFTRKPLPDYALHKFDTFITDPPETVEAIRAFVGRGI
ATLKGPGCAGYFGITRRESSLDKWREIQRVLLNEFGVVITDIIRNFNEYVNWGYVEETRAWRLLPIKVKPSYNWYKSYMF
RIQTLEGSKGFDEESSTT

The query sequence (length=338) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5xnc:B	354	353	1.0000	0.9548	0.9575	0.0	6j26:A, 6j26:B, 5xnc:A, 5xnc:C, 5xnc:D, 5xnc:E, 5xnc:F, 5xnc:G, 5xnf:A, 5xnf:B, 5xnh:A, 5xnh:H
2	2qm3:A	338	337	0.7751	0.7751	0.7774	0.0
3	6j28:A	345	348	0.4379	0.4290	0.4253	8.06e-85	6j27:A, 6j27:B, 6j27:C, 6j27:D, 6j28:C, 6j28:B, 6j28:D
4	1woo:A	362	136	0.1095	0.1022	0.2721	0.48	1wop:A, 1wor:A
5	4mnd:A	408	114	0.0858	0.0711	0.2544	1.8
6	1dgj:A	906	58	0.0533	0.0199	0.3103	2.5
7	3ldg:A	377	51	0.0444	0.0398	0.2941	2.9
8	8a8k:A	317	65	0.0621	0.0662	0.3231	2.9	8a8k:B, 8a8k:C, 8a8k:D, 8a8k:E, 8a8k:F
9	6gnc:A	287	69	0.0533	0.0627	0.2609	7.0
10	4ncl:B	435	60	0.0592	0.0460	0.3333	7.7	4ncl:A, 4ncn:A, 4ncn:B, 4tmt:A, 4tmt:B, 4tmv:B, 4tmv:A, 4tmw:A, 4tmw:B, 4tmx:A, 4tmx:B, 4tmz:B, 4tmz:A, 4tn1:B, 4tn1:A

[Back]