BioLiP

>protein
SHMREIIERVKEKTTIPVYERTIENVLSAIQASGDVWRIVDLSEEPLPLVVAVVTALYELGYVAFENNQVILTRKGKELV
EKYGIGPRADYTCSHCQGRTVEIDAFSELLEQFKEITRDRPEPAHQFDQAYVTPETTVARVALMHSRGDLENKEVFVLGD
DDLTSVALMLSGLPKRIAVLDIDERLTKFIEKAADEIGYENIEIFTFDLRPDYALHKFDTFITDPPETVEAIRAFVGRGI
ATLKGPGCAGYFGITRRESSLDKWREIQRVLLNEFGVVITDIIRNFNEYVNWGYVEETRAWRLLPIKVKPSYNWYKSYMF
RIQTLEGSKGFEDDEESSTT

The query sequence (length=340) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5xnc:B	354	353	1.0000	0.9605	0.9632	0.0	6j26:A, 6j26:B, 5xnc:A, 5xnc:C, 5xnc:D, 5xnc:E, 5xnc:F, 5xnc:G, 5xnf:A, 5xnf:B, 5xnh:A, 5xnh:H
2	2qm3:A	338	337	0.7735	0.7781	0.7804	0.0
3	6j28:A	345	348	0.4324	0.4261	0.4224	1.69e-84	6j27:A, 6j27:B, 6j27:C, 6j27:D, 6j28:C, 6j28:B, 6j28:D
4	6ixx:A	463	128	0.0794	0.0583	0.2109	0.24	1g9k:A, 1h71:P, 1o0q:A, 1o0t:A, 1om6:A, 1om7:A, 1om8:A, 1omj:A, 3u1r:A
5	6h2v:A	210	109	0.0853	0.1381	0.2661	1.3	6h2u:A, 6h2v:C
6	1woo:A	362	80	0.0765	0.0718	0.3250	1.3	1wop:A, 1wor:A
7	4mnd:A	408	114	0.0853	0.0711	0.2544	1.8
8	1dgj:A	906	58	0.0529	0.0199	0.3103	2.6
9	8a8k:A	317	65	0.0618	0.0662	0.3231	3.0	8a8k:B, 8a8k:C, 8a8k:D, 8a8k:E, 8a8k:F
10	4ncl:B	435	60	0.0588	0.0460	0.3333	7.2	4ncl:A, 4ncn:A, 4ncn:B, 4tmt:A, 4tmt:B, 4tmv:B, 4tmv:A, 4tmw:A, 4tmw:B, 4tmx:A, 4tmx:B, 4tmz:B, 4tmz:A, 4tn1:B, 4tn1:A

[Back]