SHMIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPNFLNLCVEIQTTLTVLQLLECCLKTE
ECLHRIRKERWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRYK
The query sequence (length=160) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3qbc:B | 161 | 160 | 1.0000 | 0.9938 | 1.0000 | 9.48e-118 | 4ad6:A, 4ad6:B, 4crj:A, 4cwb:A, 4cyu:A, 4cyu:B, 4cyu:C, 4cyu:D, 5etq:A, 5etq:B, 5etr:B, 5etr:A, 5ets:B, 5ets:A, 5ett:B, 5ett:A, 5etv:A, 3qbc:A |
2 | 8sk1:A | 162 | 144 | 0.4437 | 0.4383 | 0.4931 | 2.20e-44 | 8sk1:B |
3 | 1cbk:A | 160 | 142 | 0.3563 | 0.3563 | 0.4014 | 1.56e-34 | 1cbk:B |
4 | 5etl:D | 160 | 143 | 0.3625 | 0.3625 | 0.4056 | 9.61e-33 | 6an4:A, 6an6:A, 6an6:B, 1dy3:A, 1eqm:A, 5etk:A, 5etl:A, 5etl:B, 5etl:C, 5etm:A, 5etn:A, 5eto:A, 5etp:A, 1ex8:A, 4f7v:A, 1f9h:A, 1g4c:B, 3hd1:A, 3hd2:A, 1hq2:A, 3hsd:A, 3hsd:B, 3hsg:A, 3ht0:A, 3ilj:A, 3ilo:A, 3ip0:A, 7kdo:A, 7kdr:A, 3kuh:A, 4m5g:A, 4m5h:A, 4m5i:A, 4m5j:A, 4m5k:A, 4m5l:A, 4m5m:A, 4m5n:A, 4m5n:B, 1q0n:A, 1rao:A, 1rb0:A, 1rtz:A, 1ru1:A, 1ru1:B, 1ru2:A, 8sif:A, 1tmj:A, 1tmm:A, 1tmm:B, 3ud5:A, 3ude:A, 3udv:A |
5 | 2qx0:A | 159 | 139 | 0.3625 | 0.3648 | 0.4173 | 7.26e-32 | 2qx0:B |
6 | 2bmb:A | 513 | 139 | 0.3500 | 0.1092 | 0.4029 | 4.02e-24 | |
7 | 8sl9:A | 422 | 144 | 0.2500 | 0.0948 | 0.2778 | 1.39e-11 | 4pzv:A |
8 | 3mco:A | 397 | 143 | 0.2437 | 0.0982 | 0.2727 | 8.46e-11 | 3mcn:B, 3mco:B |
9 | 3mcm:A | 368 | 140 | 0.2313 | 0.1005 | 0.2643 | 4.94e-09 | 3mcn:A |
10 | 6mdw:A | 185 | 43 | 0.0875 | 0.0757 | 0.3256 | 5.1 | 6mdx:A |