SHMFYAVRRGRKTGVFLTWNECRAQVDRFPAARFKKFATEDEAWAFVRK
The query sequence (length=49) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3bsu:G | 50 | 49 | 1.0000 | 0.9800 | 1.0000 | 2.23e-31 | 3bsu:A, 3bsu:B, 3bsu:C, 3bsu:F, 3bsu:H |
2 | 6rmn:B | 222 | 45 | 0.2857 | 0.0631 | 0.3111 | 0.30 | 6shx:B, 6sns:B, 6snv:B, 6snv:E |
3 | 5jy7:B | 571 | 33 | 0.2449 | 0.0210 | 0.3636 | 1.8 | 5jy7:A, 5jy7:C, 5jy7:D, 5jy7:E, 5jy7:F, 5jy7:G, 5jy7:H, 3zo9:A, 3zo9:B, 3zoa:B, 3zoa:A |
4 | 4v6w:AT | 154 | 24 | 0.2041 | 0.0649 | 0.4167 | 4.3 | 6xu6:AT, 6xu7:AT, 6xu8:AT |
5 | 2cww:B | 382 | 23 | 0.2041 | 0.0262 | 0.4348 | 4.3 | 2cww:A |
6 | 8xuq:A | 885 | 35 | 0.2449 | 0.0136 | 0.3429 | 4.7 | 8xuo:A, 8xuo:G, 8xuq:E, 8xuq:F, 8xuq:G, 8xuv:A, 8xuv:B, 8xuv:C, 8xuv:D, 8xuv:E, 8xuv:F, 8xuv:G, 8xuv:H, 8xuv:I, 8xuv:J, 8xuv:K, 8xuv:L |
7 | 6z1p:BI | 1413 | 37 | 0.2449 | 0.0085 | 0.3243 | 6.8 | |
8 | 8rfh:A | 730 | 14 | 0.1633 | 0.0110 | 0.5714 | 7.9 | 8rfh:B |
9 | 9fp6:A | 732 | 14 | 0.1633 | 0.0109 | 0.5714 | 9.1 | 9fp6:B, 9fp6:C, 9fp6:D, 9fp6:E, 9fp6:F |